Recombinant Escherichia coli Lipopolysaccharide export system protein lptA (lptA)

In Stock
Code CSB-EP360010ENV
Abbreviation Recombinant E.coli lptA protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
lptA
Uniprot No.
Research Area
Others
Alternative Names
lptA; yhbN; b3200; JW3167; Lipopolysaccharide export system protein LptA
Species
Escherichia coli (strain K12)
Source
E.coli
Expression Region
28-185aa
Target Protein Sequence
VTGDTDQPIHIESDQQSLDMQGNVVTFTGNVIVTQGTIKINADKVVVTRPGGEQGKEVIDGYGKPATFYQMQDNGKPVEGHASQMHYELAKDFVVLTGNAYLQQVDSNIKGDKITYLVKEQKMQAFSDKGKRVTTVLVPSQLQDKNNKGQTPAQKKGN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
33.3kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Escherichia coli Lipopolysaccharide export system protein lptA is produced using an E. coli expression system. The protein includes the complete mature sequence spanning residues 28 to 185. For easier purification and detection, it carries an N-terminal 6xHis-SUMO tag. SDS-PAGE analysis shows the protein reaches over 90% purity, which should provide high-quality material for research work.

LptA appears to be a key component in E. coli's lipopolysaccharide (LPS) transport machinery. The protein likely plays an important role in assembling and moving LPS molecules across the bacterial cell envelope—a process that seems critical for outer membrane integrity and function. This makes the protein particularly useful for researchers studying bacterial membrane biology and LPS transport mechanisms.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

E. coli LptA is a periplasmic protein that functions as part of the lipopolysaccharide (LPS) transport system, requiring specific interactions with other Lpt proteins (LptC and LptB) and proper folding for its bridging function. The E. coli expression system is homologous for this protein, increasing the probability of correct folding. However, the large N-terminal SUMO tag (∼15 kDa) may sterically interfere with LptA's interaction interfaces, particularly its binding sites for LptC and LptB. While the protein may be soluble and folded at the monomer level, the probability of correct functional activity in LPS transport is moderate but requires experimental validation due to potential tag interference.

1. Protein-Protein Interaction Studies Using Pull-Down Assays

Protein-protein interactions in the Lpt complex require precise interface accessibility that may be compromised by the large N-terminal tag. The large SUMO tag may sterically block LptA's interaction interfaces with LptC and LptB, leading to false-negative results or altered binding specificity. If correctly folded, it could identify physiological partners, but results require validation with tag-free protein and complementary methods like bacterial two-hybrid systems. Any interaction data would be biologically irrelevant without validation using natively folded protein.

2. Antibody Development and Validation

This recombinant LptA serves as an excellent immunogen for generating antibodies against E. coli LptA. The mature protein sequence ensures relevant epitope coverage. The high purity minimizes antibodies against contaminants. However, antibodies may not efficiently recognize conformational epitopes dependent on the native tag-free structure.

3. Biochemical Characterization and Stability Studies

This is the essential first step to assess protein quality. Techniques like size-exclusion chromatography with multi-angle light scattering (SEC-MALS) can determine oligomeric state, while circular dichroism can analyze secondary structure and thermal stability. These studies provide critical data or evaluating the protein's physical properties.

4. In Vitro Reconstitution Assays for LPS Transport Studies

This application is not recommended without rigorous validation. Functional LPS transport requires precise stoichiometric interactions between Lpt components. The SUMO tag will likely sterically hinder proper complex formation, leading to failed reconstitution and misleading results. Tag-free LptA is essential for meaningful transport assays.

Final Recommendation & Action Plan

This SUMO-tagged recombinant LptA is primarily suitable for antibody development and biochemical characterization but requires careful validation for interaction studies and is unsuitable for functional transport assays. The immediate priority is Application 3 (Biochemical Characterization) to assess folding state via SEC-MALS and CD spectroscopy. Application 2 (Antibody Development) can proceed immediately. Application 1 (Interaction Studies) should be approached with caution and include validation with complementary methods. Avoid Application 4 (Transport Studies) entirely due to the high probability of tag interference. For functional LPS transport studies, tag-free LptA expressed in its native context is essential. Consider SUMO protease cleavage to remove the tag for more reliable interaction and functional studies.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Involved in the assembly of lipopolysaccharide (LPS). Required for the translocation of LPS from the inner membrane to the outer membrane. May form a bridge between the inner membrane and the outer membrane, via interactions with LptC and LptD, thereby facilitating LPS transfer across the periplasm.
Gene References into Functions
  1. characterization of a viable quadruple lptA mutant impaired in the assembly of the Lpt machinery, although it retains the ability to bind LPS; although viable, the quadruple lptA mutant disrupts outer membrane (OM) asymmetry and severely impairs the OM permeability barrier; analysis of 2 independent suppressors revealed different strategies adopted by the cell to overcome defects in LPS biogenesis PMID: 29109183
  2. LptA molecular structure is affected by lipopolysaccharides binding. PMID: 28419595
  3. An induced folding process characterizes the partial-loss of function mutant LptAI36D in its interactions with lipopolysaccharide constituent ligands. PMID: 26123264
  4. Studied the assembly and architecture of LptA oligomers. PMID: 23897621
  5. results suggest that LptA operate in the LPS assembly pathway and, together with other as-yet-unidentified components, could be part of a complex devoted to the transport of LPS from the periplasmic surface of the IM to the OM. PMID: 18424520
  6. LptA binds structurally diverse lipopolysaccharide (LPS) substrates in vitro and demonstrate that it interacts specifically with the lipid A domain of LPS PMID: 18480051

Show More

Hide All

Subcellular Location
Periplasm. Note=Associates with both the inner membrane and the outer membrane.
Protein Families
LptA family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*