Recombinant Escherichia coli Microcin J25-processing protein mcjB (mcjB)

In Stock
Code CSB-EP893972ENL
Abbreviation Recombinant E.coli mcjB protein
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
mcjB
Uniprot No.
Research Area
Others
Species
Escherichia coli
Source
E.coli
Expression Region
1-208aa
Target Protein Sequence
MIRYCLTSYREDLVILDIINDSFSIVPDAGSLLKERDKLLKEFPQLSYFFDSEYHIGSVSRNSDTSFLEERWFLPEPDKTLYKCSLFKRFILLLKVFYYSWNIEKKGMAWIFISNKKENRLYSLNEEHLIRKEISNLSIIFHLNIFKSDCLTYSYALKRILNSRNIDAHLVIGVRTQPFYSHSWVEVGGQVINDAPNMRDKLSVIAEI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
32.0 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Escherichia coli Microcin J25-processing protein mcjB is produced using an E. coli expression system and includes the complete protein sequence from residues 1 to 208. The protein features a dual-tag design with an N-terminal 10xHis tag and a C-terminal Myc tag, which makes purification and detection more straightforward. SDS-PAGE analysis indicates the product achieves purity levels above 85%, suggesting it should perform reliably in research settings.

Microcin J25-processing protein mcjB appears to be essential for the maturation and secretion of the antimicrobial peptide Microcin J25 in Escherichia coli. This protein likely plays a key role in post-translational modification processes and may be important for understanding how bacteria defend themselves. Studying this protein could provide insights into bacterial peptide processing pathways and contribute to research on microbial interactions and antibiotic development.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Escherichia coli Microcin J25-processing protein mcjB is a bacterial protein that requires precise folding for its role in microcin biosynthesis. The E. coli expression system is homologous to this bacterial protein, significantly increasing the probability of correct folding. The N-terminal 10xHis-tag and C-terminal Myc-tag are relatively small and positioned at opposite ends, minimizing interference with functional domains. While the homologous system supports proper folding, experimental validation remains essential to confirm functional activity.

1. Protein-Protein Interaction Studies Using His-Tag Pull-Down Assays

This application's reliability depends on proper folding validation. Protein-protein interactions within the microcin J25 pathway require precise tertiary structure. If correctly folded (verified), the protein is suitable for identifying physiological binding partners. If misfolded/unverified, there is a high risk of non-specific binding or interaction failure.

2. Antibody Development and Validation Using Dual-Tag System

Antibody development relies on antigenic sequence recognition rather than functional folding. If correctly folded (verified), the protein excels for generating conformation-sensitive antibodies. If misfolded/unverified, it remains highly suitable for producing antibodies against linear epitopes.

3. Biochemical Characterization and Enzyme Kinetics Analysis

These studies are essential for determining folding status and functional competence. If correctly folded (verified), characterization provides reliable data on enzymatic activity and kinetic parameters. If misfolded/unverified, analysis yields physical property data, but enzymatic assays will not reflect native activity.

4. Protein Complex Assembly and Stoichiometry Studies

Complex assembly requires precise tertiary and quaternary structure. If correctly folded (verified), the protein enables valid studies of complex formation and stoichiometry. If misfolded/unverified, assembly experiments will yield misleading results.

Final Recommendation & Action Plan

The homologous E. coli expression system provides favorable conditions for this bacterial protein, but experimental validation of structural integrity and functional activity is essential before reliable use in interaction and complex studies. Begin with Application 3 (Biochemical Characterization) to assess folding quality through techniques like size-exclusion chromatography and validate enzymatic activity using microcin J25 precursor substrates. Once correct folding and activity are verified, proceed cautiously with Applications 1 and 4 for interaction studies and complex assembly. Application 2 (antibody development) can proceed immediately regardless of folding status. If misfolding is detected, limit applications to linear epitope antibody production and basic biophysical characterization, avoiding all functional interaction and complex studies. For reliable mcjB research, always include appropriate activity controls and consider using tag-free variants for critical functional assays.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Along with McjC, necessary and sufficient to process the inactive microcin J25 (McjA) precursor into the active peptide.
Subcellular Location
Cytoplasm.
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*