Recombinant Escherichia coli O157:H7 NADH pyrophosphatase (nudC)

In Stock
Code CSB-EP845206EOD
Abbreviation Recombinant E.coli O157:H7 nudC protein
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
nudC
Uniprot No.
Research Area
Cell Biology
Species
Escherichia coli O157:H7
Source
E.coli
Expression Region
1-257aa
Target Protein Sequence
MDRIIEKLDHGWWVVSHEQKLWLPKGELPYGEAANFDLVGQRALQIGEWQGEPVWLIQQQRRYDMGSVRQVIDLDVGLFQLAGRGVQLAEFYRSHKYCGYCGHEMYPSKTEWAMLCSHCRERYYPQIAPCIIVAIRRDDSILLAQHTRHRNGVHTVLAGFVEVGETLEQAVAREVMEESGIKVKHLRYVTSQPWPFPQSLMTAFMAEYDSGDIVIDPKELLEANWYRYDDLPLLPPPGTVARRLIEDTVAMCRAEYE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
33.8 kDa
Protein Length
Full length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Escherichia coli O157:H7 NADH pyrophosphatase (nudC) is expressed in E. coli and features an N-terminal 6xHis-tag for simplified purification. This full-length protein spans 1-257 amino acids and achieves a purity greater than 85% as verified by SDS-PAGE. This product is designed exclusively for research use and is not intended for therapeutic or diagnostic applications.

NADH pyrophosphatase, encoded by the nudC gene, appears to be involved in regulating NADH levels within the cell. It likely plays a critical role in maintaining cellular redox balance by hydrolyzing NADH, thus influencing various metabolic pathways. Studying this enzyme may be important for understanding bacterial metabolism and energy management, making it a significant focus in microbiological research.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Because nudC is a bacterial enzyme that naturally occurs in E. coli and does not require complex post-translational modifications or eukaryotic chaperones for folding or activity, expression in E. coli is highly likely to yield a properly folded, catalytically active enzyme. Numerous studies have shown that bacterial NADH pyrophosphatases expressed recombinantly in E. coli retain enzymatic activity comparable to the native enzyme. While this recombinant protein is very likely to be correctly folded and enzymatically functional, direct enzymatic validation (e.g., NADH hydrolysis assay) should still be performed to confirm activity before using it in mechanistic or kinetic studies.

1. Biochemical Characterization of NADH Pyrophosphatase Activity

This recombinant nudC protein is well suited for enzymatic assays measuring NADH pyrophosphatase activity, including determination of kinetic parameters (Km, Vmax), substrate specificity, and cofactor dependence. Since the enzyme is expressed full-length in E. coli, which is its native host type, correct folding and catalytic activity are very likely, although confirmation by enzyme activity assay is recommended. The His-tag facilitates purification and quantification, supporting accurate biochemical and kinetic analyses.

2. Comparative Enzyme Studies Between Pathogenic and Non-pathogenic E. coli Strains

This recombinant nudC protein can be used to compare NADH pyrophosphatase activity and structure between E. coli O157:H7 and non-pathogenic strains. Because the enzyme is likely correctly folded and functional, these comparisons can provide reliable data on possible virulence-related or metabolic differences. If activity validation confirms native folding, the protein will serve as a useful reference enzyme for cross-strain biochemical and evolutionary studies.

3. Antibody Development and Immunological Studies

The recombinant protein can be used as an antigen for antibody production (polyclonal or monoclonal) targeting E. coli O157:H7 nudC. Its high purity and bacterial origin minimize immunogenic interference, and the His-tag facilitates downstream assay use (e.g., ELISA or Western blot). The protein’s likely native folding supports antibody generation recognizing both linear and conformational epitopes, though activity confirmation should precede any assumption of structural integrity.

4. Protein-Protein Interaction Studies

The His-tagged full-length nudC can be immobilized on nickel-affinity matrices for pull-down assays to explore potential interactions with other bacterial proteins in NADH metabolism.
Because bacterial expression likely yields a correctly folded enzyme, native-like interactions could be observed. However, interactions should be validated under physiological conditions to ensure biological relevance.

5. Structural Biology and Protein Folding Studies

This recombinant full-length nudC protein (1–257aa) is suitable for X-ray crystallography, NMR, or cryo-EM due to its small size and high purity. Given its bacterial expression and likely proper folding, structural studies are feasible without extensive refolding steps. Biophysical characterization (CD spectroscopy, DSC, DLS) can further confirm structural integrity and thermal stability.
If activity assays confirm functionality, the protein can serve as a model system for catalytic mechanism analysis.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
mRNA decapping enzyme that specifically removes the nicotinamide adenine dinucleotide (NAD) cap from a subset of mRNAs by hydrolyzing the diphosphate linkage to produce nicotinamide mononucleotide (NMN) and 5' monophosphate mRNA. The NAD-cap is present at the 5'-end of some mRNAs and stabilizes RNA against 5'-processing. Has preference for mRNAs with a 5'-end purine. Catalyzes the hydrolysis of a broad range of dinucleotide pyrophosphates.
Protein Families
Nudix hydrolase family, NudC subfamily
Database Links

KEGG: ece:Z5571

STRING: 155864.Z5571

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*