Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

degP

Uniprot No.

P0C0V0

Research Area

Others

Alternative Names

degP; htrA; ptd; b0161; JW0157; Periplasmic serine endoprotease DegP; EC 3.4.21.107; Heat shock protein DegP; Protease Do

Species

Escherichia coli (strain K12)

Source

E.coli

Expression Region

27-474aa

Target Protein Sequence

AETSSATTAQQMPSLAPMLEKVMPSVVSINVEGSTTVNTPRMPRNFQQFFGDDSPFCQEGSPFQSSPFCQGGQGGNGGGQQQKFMALGSGVIIDADKGYVVTNNHVVDNATVIKVQLSDGRKFDAKMVGKDPRSDIALIQIQNPKNLTAIKMADSDALRVGDYTVAIGNPFGLGETVTSGIVSALGRSGLNAENYENFIQTDAAINRGNSGGALVNLNGELIGINTAILAPDGGNIGIGFAIPSNMVKNLTSQMVEYGQVKRGELGIMGTELNSELAKAMKVDAQRGAFVSQVLPNSSAAKAGIKAGDVITSLNGKPISSFAALRAQVGTMPVGSKLTLGLLRDGKQVNVNLELQQSSQNQVDSSSIFNGIEGAEMSNKGKDQGVVVNNVKTGTPAAQIGLKKGDVIIGANQQAVKNIAELRKVLDSKPSVLALNIQRGDSTIYLLMQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

62.8kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The production of this recombinant E.coli degP protein is just like all recombinant proteins. The process involved transfecting E.coli cells with DNA vector containing the template of recombinant DNA. The E.coli cells containing the template were then cultured so that they could transcribe and translate the degP protein. N-terminal 6xHis-SUMO tag was used in the process. The purity is 90% determined by SDS-PAGE.

degP is a gene providing instructions for making a protein called periplasmic serine endoprotease DegP (also known as heat shock protein DegP or protease Do). DegP protein belongs to the peptidase S1C family. DegP is a heat shock protein induced in response to pac overexpression, suggesting that the protein could possibly suppress the physiological toxicity caused by pac overexpression. Increasing evidence indicates that the production of soluble recombinant penicillin acylase in Escherichia coli can be enhanced via coexpression of a periplasmic protease/chaperone, DegP.

Target Background

Function

DegP acts as a chaperone at low temperatures but switches to a peptidase (heat shock protein) at higher temperatures. Degrades transiently denatured and unfolded or misfolded proteins which accumulate in the periplasm following heat shock or other stress conditions. DegP is efficient with Val-Xaa and Ile-Xaa peptide bonds, suggesting a preference for beta-branched side chain amino acids. Only unfolded proteins devoid of disulfide bonds appear capable of being cleaved, thereby preventing non-specific proteolysis of folded proteins. Its proteolytic activity is essential for the survival of cells at elevated temperatures. It can degrade IciA, Ada, casein, globin and PapA. DegP shares specificity with DegQ. DegP is also involved in the biogenesis of partially folded outer-membrane proteins (OMP).

Gene References into Functions

Our results suggest that YjfN is a novel "suicide activator" for DegP that enhances DegP proteolysis under misfolded protein stress. PMID: 28947671
Investigated the influence of amino acid substitutions located within the LD loop on the kinetics of a model substrate cleavage as well as on the dynamics of the oligomeric structure of HtrA. We found that the mutations that were expected to disturb the loop's structure and/or interactions with the remaining regulatory loops severely diminished the proteolytic activity of HtrA. PMID: 27469236
In the present review, we summarize recent advances in the characterization of these key factors, with a special emphasis on the multifunctional protein DegP. PMID: 25849907
The lack of the disulfide within LA affected the stability and the overall structure of the HtrA molecule. PMID: 25710793
Sensitive activation and cage assembly needs covalent linkage of distinct substrate sequences that affect degradation (degrons); 1 degron binds the DegP active site, a 2nd degron binds a separate tethering site in PDZ1 of a substrate-bound DegP dodecamer. PMID: 21458668
Formation of contacts between the apical parts (residues 231-234) of the L2 loops within the HtrA trimer, in particular the residue D232, was shown to play a crucial role in the activation process of HtrA. PMID: 20515644
Effector-peptide binding to the PDZ domain of DegP induces oligomer conversion from resting hexameric DegP6 into proteolytically active 12-mers and 24-mers. PMID: 20581825
The combined introduction of loop L2 and PDZ domain 1 of DegP into DegS converted DegS even further into a DegP-like protease. PMID: 20184896
the osmoregulation of the expression of htrA gene; role of the nucleoid associated proteins H-NS and Hha in the repression of htrA expression at low osmolarity PMID: 16143461
the N-terminal alpha-helix is an important functional domain for inhibition of the Cpx pathway and that CpxP is subject to DegP-dependent proteolysis PMID: 16166523
CpxP functions as a periplasmic adaptor protein that is required for the effective proteolysis of a subset of misfolded substrates by the DegP protease PMID: 16303867
Results show that the functional unit for the protease and chaperone activities of DegP is a trimer and that neither a cavity of specific dimensions nor the presence of an enclosed cavity appears to be essential for its protease and chaperone activities. PMID: 17122339
HtrA may protect the bacterial cells from deleterious effects of heat shock not only by degrading the damaged proteins but by combination of the proteolytic and chaperoning activities PMID: 17485069
This article summarizes recent studies regarding the HtrA family of proteins, their structure, regulation and function. It also presents practical applications of this knowledge and perspective of its use in the future. PMID: 17718385
HtrA can in fact act as a protease at low temperatures. PMID: 19047732
Review show that DegP adopts various forms, depending on the surrounding environment and the availability of a substrate. PMID: 19465652

Hide All

Subcellular Location

Cell inner membrane; Peripheral membrane protein; Cytoplasmic side.

Protein Families

Peptidase S1C family

Database Links

KEGG: ecj:JW0157

STRING: 316385.ECDH10B_0141

Code	CSB-EP314631ENV
MSDS	MSDS Datasheet
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Escherichia coli Periplasmic serine endoprotease DegP (degP)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage