Recombinant Gloydius ussuriensis Thrombin-like enzyme calobin-1

In Stock
Code CSB-EP838597GGS
Abbreviation Recombinant Gloydius ussuriensis Thrombin-like enzyme calobin-1 protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
N/A
Uniprot No.
Research Area
Others
Alternative Names
; Thrombin-like enzyme calobin-1; SVTLE; EC 3.4.21.-; Calobin I; Fibrinogen-clotting enzyme; Snake venom serine protease; SVSP
Species
Gloydius ussuriensis (Ussuri mamushi) (Gloydius blomhoffii ussuriensis)
Source
E.coli
Expression Region
25-262aa
Target Protein Sequence
VIGGDECNINEHRFLVALYNSRSRTLFCGGTLINQEWVLTAAHCERKNFRIKLGIHSKKVPNEDEQTRVPKEKFFCLSSKNYTLWDKDIMLIRLDSPVSNSEHIAPLSLPSSPPSVGSVCRIMGWGRISPTKETYPDVPHCANINLLEYEMCRAPYPEFGLPATSRTLCAGILEGGKDTCRGDSGGPLICNGQFQGIASWGDDPCAQPHKPAAYTKVFDHLDWIQSIIAGNTDASCPP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
33.7 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Gloydius ussuriensis Thrombin-like enzyme calobin-1 gets expressed in E. coli and spans the full length of the mature protein, covering amino acids 25 to 262. Scientists have engineered the protein with an N-terminal 10xHis tag and a C-terminal Myc tag to make purification and detection more straightforward. SDS-PAGE analysis shows it reaches a purity greater than 85%, which appears suitable for reliable experimental work in research settings.

Thrombin-like enzyme calobin-1 is a serine protease that comes from Gloydius ussuriensis snake venom. The enzyme mimics thrombin's activity by cleaving fibrinogen—a process that plays a crucial role in blood coagulation pathways. Researchers often turn to this enzyme when studying hemostasis and thrombosis, as it may provide insights into blood clotting mechanisms and potential therapeutic applications.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

As a snake venom serine protease, calobin-1 requires precise folding, correct disulfide bond formation, and specific tertiary structure for its functional activity in fibrinogen cleavage. The E. coli expression system cannot provide the necessary eukaryotic oxidative environment for proper disulfide bond formation, which is critical for enzyme stability and activity. The large dual tags may cause significant steric interference with the protein's active site and functional domains. While the protein contains all functional residues, the probability of correct folding with functional enzymatic activity is extremely low without experimental validation.

1. Biochemical Characterization and Enzyme Kinetics Studies

This application carries extreme risk without functional validation. Thrombin-like enzyme activity requires precise active site formation and proper disulfide bonding that E. coli cannot guarantee. If misfolded/inactive (highly probable), kinetic measurements will yield biologically meaningless results. Only if correctly folded and active (requires extensive enzymatic validation) could limited studies be attempted, but tag interference remains a major concern.

2. Antibody Development and Immunological Studies

This application is feasible as antibody development relies on antigenic sequence recognition rather than functional folding. The full-length mature protein provides comprehensive epitope coverage for generating calobin-1-specific antibodies. However, antibodies may primarily target linear epitopes and not recognize conformational epitopes of the native enzyme, limiting their utility for functional studies.

3. Protein-Protein Interaction Studies

This application carries a high risk without folding validation. Thrombin-like enzyme interactions with substrates or inhibitors require native conformation. If misfolded (likely), there is a high risk of non-specific binding or tag-mediated artefacts, yielding biologically misleading results. Proper folding and functional validation are essential prerequisites.

Final Recommendation & Action Plan

This E. coli-expressed calobin-1 with dual tags is unsuitable for most functional studies due to the essential requirements for disulfide bond formation and proper folding that cannot be reliably achieved in this expression system. For reliable calobin-1 research, alternative approaches should be pursued, including using eukaryotic expression systems (e.g., insect or mammalian cells) that support proper oxidative folding, or implementing refolding protocols with extensive activity validation using synthetic substrates or fibrinogen cleavage assays. All applications should include appropriate controls and validation steps to ensure data reliability.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Thrombin-like snake venom serine protease. Has a coagulant activity. Acts on alpha-chains of fibrinogen (FGA) generating fibrinopeptide A.
Subcellular Location
Secreted.
Protein Families
Peptidase S1 family, Snake venom subfamily
Tissue Specificity
Expressed by the venom gland.
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*