Purity
Greater than 85% as determined by SDS-PAGE.
Species
Griffithsia sp. (strain Q66D336) (Red alga)
Expression Region
1-121aa(X31S)
Target Protein Sequence
SLTHRKFGGSGGSPFSGLSSIAVRSGSYLDSIIIDGVHHGGSGGNLSPTFTFGSGEYISNMTIRSGDYIDNISFETNMGRRFGPYGGSGGSANTLSNVKVIQINGSAGDYLDSLDIYYEQY
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full length
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The production of this Recombinant Griffithsia sp. Griffithsin began at the genetic level, where the coding sequence for the protein was first isolated and cloned into an expression plasmid vector. Recombinant DNA technology was used in the process. Next step was cloning. The expression vector must be introduced into the host cell (E.coli) so that the cells could be cultured and expressed the desired Griffithsin protein. And we finally got the recombinant Griffithsin protein with the purity of 85%+ determined by SDS-PAGE.
Griffithsin, derived from Griffithsia spp. marine red algae, is a small lectin consisting of 121 amino acids. Grifthsin is a domain-swapped dimer and each subunit has three nearly equivalent glycan-binding sites. Grifthsin binds glycan moieties associated with the glycoproteins of several enveloped viruses, resulting in inhibition of infectivity. Grifthsin has been shown to exhibit significant antiviral activity against human enveloped viruses including HIV, Middle East respiratory syndrome coronavirus (MERS-CoV), and severe acute respiratory syndrome corona virus (SARS-CoV), hepatitis C virus (HCV), herpes simplex virus 2 (HSV-2), and Japanese encephalitis virus (JEV). Moreover, Grifthsin shows excellent thermostability and is resistant to organic solvents and protease degradation. It possesses a superior safety profile: no cytotoxicity was observed against a variety of cell types, nor any major effects on peripheral blood mononuclear cell activation or cytokine and chemokine production. Thus, Grifthsin is an attractive candidate for development as an antiviral therapeutic.