Recombinant Griffithsia sp. Griffithsin (X31S)

In Stock
Code CSB-EP307563GDJ
Abbreviation Recombinant Griffithsia sp. Griffithsin protein (X31S)
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
N/A
Uniprot No.
Research Area
others
Species
Griffithsia sp. (strain Q66D336) (Red alga)
Source
E.coli
Expression Region
1-121aa(X31S)
Target Protein Sequence
SLTHRKFGGSGGSPFSGLSSIAVRSGSYLDSIIIDGVHHGGSGGNLSPTFTFGSGEYISNMTIRSGDYIDNISFETNMGRRFGPYGGSGGSANTLSNVKVIQINGSAGDYLDSLDIYYEQY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
20.2 kDa
Protein Length
Full length
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The first step in producing the recombinant Griffithsia sp. Griffithsin protein is to construct a plasmid that contains the Griffithsia sp. Griffithsin protein (1-121aa(X31S)) encoding gene along with the N-terminal 10xHis-tag gene and C-terminal Myc-tag gene. The next is to transform this plasmid into E.coli cells and select positive E.coli cells, from which positive cells can be screened and cultured to express the protein. The recombinant Griffithsia sp. Griffithsin protein is purified through affinity purification from the cell lysate. Its purity is greater than 85%, determined by the SDS-PAGE analysis.

Griffithsin (GRFT) is a 121 amino acid lectin derived from the red marine alga Griffithsia sp. It is a broad-spectrum antiviral protein that has shown potent activity against various glycosylated viruses, including HIV, hepatitis C virus, SARS coronavirus, Japanese encephalitis virus, and herpes simplex virus [1][2][3]. Griffithsin exhibits its antiviral activity by binding to oligomannose glycans found on viral envelope glycoproteins, thereby preventing viral entry and infection [4][5]. The lectin has been found to have a unique structure with six independent sugar binding sites, allowing it to bind to multiple individual sugars on large oligosaccharides, such as Man9GlcNAc2 [4]. This ability enables Griffithsin to interact with various enveloped viruses effectively.

Moreover, Griffithsin has been identified as a potent inhibitor of viruses like HCV, SARS coronavirus, Middle East respiratory syndrome coronavirus, and herpes simplex virus, both in vitro and in vivo, while demonstrating minimal toxicity [3]. Lectin has also been suggested as a promising candidate for microbicide development due to its high mannose-targeting properties and potential to prevent viral infections [6][7]. Additionally, Griffithsin has been explored for large-scale production using plant-based systems like Nicotiana excelsiana, indicating its potential for cost-effective manufacturing [8][9].

References:
[1] H. Ishag, C. Li, L. Huang, M. Sun, F. Wang, B. Niet al., Griffithsin inhibits japanese encephalitis virus infection in vitro and in vivo, Archives of Virology, vol. 158, no. 2, p. 349-358, 2012. https://doi.org/10.1007/s00705-012-1489-2
[2] J. Xue, B. Hoorelbeke, I. Kagiampakis, B. Demeler, J. Balzarini, & P. LiWang, The griffithsin dimer is required for high-potency inhibition of hiv-1: evidence for manipulation of the structure of gp120 as part of the griffithsin dimer mechanism, Antimicrobial Agents and Chemotherapy, vol. 57, no. 8, p. 3976-3989, 2013. https://doi.org/10.1128/aac.00332-13
[3] J. Millet, K. Séron, R. Labitt, A. Danneels, K. Palmer, G. Whittakeret al., Middle east respiratory syndrome coronavirus infection is inhibited by griffithsin, Antiviral Research, vol. 133, p. 1-8, 2016. https://doi.org/10.1016/j.antiviral.2016.07.011
[4] N. Ziółkowska, S. Shenoy, B. O’Keefe, J. McMahon, K. Palmer, R. Dweket al., Crystallographic, thermodynamic, and molecular modeling studies of the mode of binding of oligosaccharides to the potent antiviral protein griffithsin, Proteins Structure Function and Bioinformatics, vol. 67, no. 3, p. 661-670, 2007. https://doi.org/10.1002/prot.21336
[5] A. Alam, L. Jiang, G. Kittleson, K. Steadman, S. Nandi, J. Fuquaet al., Technoeconomic modeling of plant-based griffithsin manufacturing, Frontiers in Bioengineering and Biotechnology, vol. 6, 2018. https://doi.org/10.3389/fbioe.2018.00102
[6] J. Fuqua, V. Wanga, & K. Palmer, Improving the large scale purification of the hiv microbicide, griffithsin, BMC Biotechnology, vol. 15, no. 1, 2015. https://doi.org/10.1186/s12896-015-0120-5
[7] N. Ziółkowska, B. O'Keefe, T. Mori, C. Zhu, B. Giomarelli, F. Vojdaniet al., Domain-swapped structure of the potent antiviral protein griffithsin and its mode of carbohydrate binding, Structure, vol. 14, no. 7, p. 1127-1135, 2006. https://doi.org/10.1016/j.str.2006.05.017
[8] P. Eapen, J. Cates, R. Mundell, K. Palmer, & J. Fuqua, In preparation for outdoor pharming: griffithsin can be expressed in nicotiana excelsiana and retains activity after storage as silage, Frontiers in Bioengineering and Biotechnology, vol. 8, 2020. https://doi.org/10.3389/fbioe.2020.00199
[9] J. Decker, R. Menacho‐Melgar, & M. Lynch, Low-cost, large-scale production of the anti-viral lectin griffithsin, Frontiers in Bioengineering and Biotechnology, vol. 8, 2020. https://doi.org/10.3389/fbioe.2020.01020

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Mixed specificity lectin with anti-HIV activity. Binds to HIV envelope glycoproteins, including exterior membrane glycoprotein gp120, and inhibits viral entry into cells. Binding to gp120 is dependent on gp120 being glycosylated, and is inhibited by mannose, glucose and N-acetylglucosamine.
Protein Families
Jacalin lectin family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*