Recombinant Hamster polyomavirus Major capsid protein VP1

In Stock
Code CSB-EP355947HBZ
Abbreviation Recombinant Hamster polyomavirus Major capsid protein VP1 protein
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
N/A
Uniprot No.
Research Area
Immunology
Alternative Names
Major structural protein VP1
Species
Hamster polyomavirus (HaPyV) (Mesocricetus auratus polyomavirus 1)
Source
E.coli
Expression Region
1-372aa
Target Protein Sequence
MCKPLWKPCPKPANVPKLIMRGGVGVLDLVTGEDSITQIEAYLNPRMGQNKPGTGTDGQYYGFSQSIKVNSSLTADEVKANQLPYYSMAKIQLPTLNEDLTCDTLQMWEAVSVKTEVVGVGSLLNVHGYGSRSETKDIGISKPVEGTTYHMFAVGGEPLDLQGLVQNYNANYEAAIVSIKTVTGKAMTSTNQVLDPTAKAKLDKDGRYPIEIWGPDPSKNENSRYYGNFTGGTGTPPVMQFTNTLTTVLLDENGVGPLCKGDGLYLSAADVMGWYIEYNSAGWHWRGLPRYFNVTLRKRWVKNPYPVTSLLASLYNNMLPTIEGQPMEGEAAQVEEVRIYEGTEAVPGDPDVNRFIDKYGQQHTKPPAKPAN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
48.3 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant hamster polyomavirus major capsid protein VP1 generation begins with isolating the target gene, which covers the full-length VP1 (1-372aa). This gene is linked with an N-terminal 10xHis-tag and C-terminal Myc-tag gene and then cloned into an expression vector, which is transfected into E. coli cells for protein expression. The recombinant VP1 protein is purified from the cell lysate through affinity chromatography. Its purity is over 85% as determined by SDS-PAGE.

The HaPyV VP1 protein is the major capsid protein of the Hamster Polyomavirus. Research has shown that the HaPyV VP1 protein can be utilized as a carrier for creating autologous, chimeric, and mosaic VLPs, which are valuable in producing epitope-specific antibodies [1]. The authentic HaPyV VP1 protein consists of 384 amino acid residues and has been successfully used in the assembly of VLPs [2]. Furthermore, the HaPyV VP1 protein has been exploited for generating chimeric VLPs with foreign epitopes or pseudotype VLPs when co-expressed with the minor capsid protein VP2, demonstrating its versatility in VLP production [3].

Studies have highlighted the immunogenicity of HaPyV VP1-derived VLPs, showcasing their ability to induce specific immune responses. These VLPs have been used as carriers for cytotoxic T-cell epitopes, tumor-associated epitopes, and other antigenic sequences, emphasizing their potential in vaccine development and immunotherapy [4]. Additionally, the HaPyV VP1 protein has been instrumental in the production of pseudotype VLPs displaying neutralizing antibody fragments, further underlining its significance in antibody generation [5].

References:
[1] B. Jandrig, H. Krause, W. Zimmermann, E. Vasiliūnaitė, A. Gedvilaitė, & R. Ulrich, Hamster polyomavirus research: past, present, and future, Viruses, vol. 13, no. 5, p. 907, 2021. https://doi.org/10.3390/v13050907
[2] T. Voronkova, A. Kazāks, V. Ose, M. Özel, S. Scherneck, P. Pumpenset al., Hamster polyomavirus-derived virus-like particles are able to transfer in vitro encapsidated plasmid dna to mammalian cells, Virus Genes, vol. 34, no. 3, p. 303-314, 2007. https://doi.org/10.1007/s11262-006-0028-1
[3] M. Pleckaityte, C. Bremer, A. Gedvilaite, I. Kucinskaite-Kodze, D. Glebe, & A. Zvirbliene, Construction of polyomavirus-derived pseudotype virus-like particles displaying a functionally active neutralizing antibody against hepatitis b virus surface antigen, BMC Biotechnology, vol. 15, no. 1, 2015. https://doi.org/10.1186/s12896-015-0203-3
[4] D. Dorn, R. Lawatscheck, A. Zvirbliene, E. Aleksaitė, G. Pecher, K. Sasnauskaset al., Cellular and humoral immunogenicity of hamster polyomavirus-derived virus-like particles harboring a mucin 1 cytotoxic t-cell epitope, Viral Immunology, vol. 21, no. 1, p. 12-26, 2008. https://doi.org/10.1089/vim.2007.0085
[5] M. Pleckaityte, A. Zvirbliene, I. Sezaite, & A. Gedvilaite, Production in yeast of pseudotype virus-like particles harboring functionally active antibody fragments neutralizing the cytolytic activity of vaginolysin, Microbial Cell Factories, vol. 10, no. 1, 2011. https://doi.org/10.1186/1475-2859-10-109

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Forms an icosahedral capsid with a T=7 symmetry and a 40 nm diameter. The capsid is composed of 72 pentamers linked to each other by disulfide bonds and associated with VP2 or VP3 proteins. Interacts with sialic acids on the cell surface to provide virion attachment to target cell. Once attached, the virion is internalized by endocytosis and traffics to the endoplasmic reticulum. Inside the endoplasmic reticulum, the protein folding machinery isomerizes VP1 interpentamer disulfide bonds, thereby triggering initial uncoating. Next, the virion uses the endoplasmic reticulum-associated degradation machinery to probably translocate in the cytosol before reaching the nucleus. Nuclear entry of the viral DNA involves the selective exposure and importin recognition of VP2/Vp3 nuclear localization signal. In late phase of infection, neo-synthesized VP1 encapsulates replicated genomic DNA in the nucleus, and participates in rearranging nucleosomes around the viral DNA.
Subcellular Location
Virion. Host nucleus.
Protein Families
Polyomaviruses coat protein VP1 family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*