Recombinant Hordeum vulgare Oxalate oxidase 1

In Stock
Code CSB-EP332739HWQ
Abbreviation Recombinant Hordeum vulgare Oxalate oxidase 1 protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Oxalate oxidase 1; EC 1.2.3.4; Germin
Species
Hordeum vulgare (Barley)
Source
E.coli
Expression Region
1-201aa
Target Protein Sequence
SDPDPLQDFCVADLDGKAVSVNGHTCKPMSEAGDDFLFSSKLTKAGNTSTPNGSAVTELDVAEWPGTNTLGVSMNRVDFAPGGTNPPHIHPRATEIGMVMKGELLVGILGSLDSGNKLYSRVVRAGETFVIPRGLMHFQFNVGKTEAYMVVSFNSQNPGIVFVPLTLFGSDPPIPTPVLTKALRVEAGVVELLKSKFAGGS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
28.2 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Hordeum vulgare Oxalate oxidase 1 production in E. coli involves several stages. Initially, the gene encoding the full-length Hordeum vulgare Oxalate oxidase 1 (1-201aa) is co-cloned into an expression vector with an N-terminal 10xHis-tag and C-terminal Myc-tag gene and transformed into E. coli cells. The bacteria are grown under conditions that induce protein expression. After sufficient growth, the cells are lysed to release the recombinant protein. The collected proteins are subjected to affinity chromatography purification. Protein purity is assessed using SDS-PAGE, exceeding 90%.

Hordeum vulgare Oxalate oxidase 1 (OXO1) is an enzyme that plays a crucial role in degrading oxalate into carbon dioxide and hydrogen peroxide [1]. This enzyme has been characterized in barley, and its biochemical functions are still being further investigated [1].

Research has shown that Hordeum vulgare OXO1 requires manganese for its catalytic activity, and its crystal structure reveals specific binding motifs for this metal ion [2]. Furthermore, Hordeum vulgare OXO1 has been associated with plant defense mechanisms, as its activity increases in barley and wheat leaves following infection with the powdery mildew fungus [3]. This enzyme's importance in plant-pathogen interactions highlights its role in plant immunity and defense responses.

Moreover, HvOXO1 has been linked to biotransformation processes in barley cells, demonstrating oxidase and epimerase activities in converting compounds like podophyllotoxin into isopicropodophyllone [4][5]. The enzyme's involvement in these biotransformation pathways showcases its versatility and significance in plant metabolism.

References:
[1] B. Dumas, G. Freyssinet, & K. Pallett, Tissue-specific expression of germin-like oxalate oxidase during development and fungal infection of barley seedlings, Plant Physiology, vol. 107, no. 4, p. 1091-1096, 1995. https://doi.org/10.1104/pp.107.4.1091
[2] H. Pan, M. Whittaker, R. Bouveret, A. Berna, F. Bernier, & J. Whittaker, Characterization of wheat germin (oxalate oxidase) expressed by pichia pastoris, Biochemical and Biophysical Research Communications, vol. 356, no. 4, p. 925-929, 2007. https://doi.org/10.1016/j.bbrc.2007.03.097
[3] F. Zhou, Z. Zhang, P. Gregersen, J. Mikkelsen, E. Neergaard, D. Collingeet al., Molecular characterization of the oxalate oxidase involved in the response of barley to the powdery mildew fungus1, Plant Physiology, vol. 117, no. 1, p. 33-41, 1998. https://doi.org/10.1104/pp.117.1.33
[4] R. Teng, D. McManus, J. Aylward, S. Ogbourne, D. Armstrong, S. Mauet al., Biotransformation of ingenol-3-angelate in four plant cell suspension cultures, Biocatalysis and Biotransformation, vol. 27, no. 3, p. 186-194, 2009. https://doi.org/10.1080/10242420902811105
[5] R. Teng, D. McManus, S. Mau, & A. Bacic, Biotransformation of podophyllotoxin byhordeum vulgarecell suspension cultures, Biocatalysis and Biotransformation, vol. 25, no. 1, p. 1-8, 2007. https://doi.org/10.1080/10242420601051201

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Releases hydrogen peroxide in the apoplast which may be important for cross-linking reactions in the cell wall biochemistry. May play an important role in several aspects of plant growth and defense mechanisms.
Subcellular Location
Secreted, extracellular space, apoplast. Secreted, cell wall.
Protein Families
Germin family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*