Recombinant Human 14 kDa phosphohistidine phosphatase (PHPT1)

Code CSB-EP017942HU
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
PHPT1
Uniprot No.
Research Area
Cell Biology
Alternative Names
14 kDa phosphohistidine phosphatase; CGI 202; HSPC141; Phosphohistidine phosphatase 1; PHP14; PHP14_HUMAN; PHPT1; Protein janus A homolog; Protein janus-A homolog; Sex regulated protein janus a
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-125aa
Target Protein Sequence
MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
40.8kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This Human PHPT1 recombinant protein was produced in E.coli, where the gene sequence encoding Human PHPT1 (1-125aa) was expressed with the N-terminal GST tag. The purity of this PHPT1 protein was greater than 90% by SDS-PAGE.
PHPT1 is an enzyme with its main function being the dephosphorylation of phosphorylated histidine residues. This enzyme catalyzes the removal of phosphate groups from histidine, thereby regulating signal transduction pathways associated with phosphorylation. Phosphorylation is a crucial cellular signaling mechanism that can regulate the activity, interactions, and processes of proteins. PHPT1, by dephosphorylating histidine residues, participates in maintaining the balance of intracellular phosphorylation, thus impacting multiple signaling pathways.
Some studies suggest that PHPT1 may be related to the development and progression of cancer. It can affect various biological processes associated with cancer, including cell apoptosis, proliferation, and invasion. Therefore, investigating the role of PHPT1 in cancer holds potential importance for understanding and treating cancer. In addition to its role in signaling, PHPT1 may also play a role in other physiological processes such as cell cytoskeleton remodeling, cell differentiation, and cell adhesion. Further research is ongoing to elucidate these functions.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Exhibits phosphohistidine phosphatase activity.
Gene References into Functions
  1. In the process of assay optimization, we discovered that PHPT1 is sensitive to a reducing environment and inhibited by transition-metal ions, with one apparent Cu(II) binding site with IC50 value of 500 +/- 20 muM and two apparent Zn(II) binding sites with IC50 values of 25 +/- 1 and 490 +/- 20 muM PMID: 29630837
  2. High PHPT1 expression is associated with cancer. PMID: 29787434
  3. H2O2 exposure induces selective oxidation of hPHPT1 at Met95, a residue within the substrate binding region. Molecular dynamics simulations suggest that if Met95 oxidation alters hPHPT1 activity, then it will do so by altering the stability of an intermediate state. Mass spectrometry showed that H2O2-induced oxidation does not impact hPHPT1 function negatively. PMID: 27034094
  4. PHPT1 was expressed in the epithelium of proximal tubuli and nuclei of clear-cell renal cell carcinoma tissue samples. PMID: 26537769
  5. PHPT1 can dephosphorylate phospholysine in chemically phosphorylated histone H1 and polylysine PMID: 25574816
  6. The specific degradation of the PHPT1 splice variant indicates that the quality control and the self-guarding of the cellular system works at two levels, first at the RNA level and proteasome level. PMID: 25450458
  7. the histidine phosphatase, protein histidine phosphatase 1, inhibits NDPK-B-activated TRPV5 in inside/out patch experiments. PMID: 24523290
  8. Overexpression of PHP by the use of a plasmid vector, pIRES2-AcGFP1-PHP, induced apoptosis in HUVEC PMID: 21967643
  9. Significantly higher expression levels of PHPT1 protein were found in lung cancer samples than in normal tissues adjacent to lung cancer. PMID: 21163124
  10. these data implicate regulatory roles for PHPT1 in a G protein-sensitive step involved in nutrient-induced insulin secretion PMID: 20501872
  11. These results demonstrate for the first time that PHP14 may be functionally important in lung cancer cell migration and the invasion of lung cancer cells, mediated partly through modulation of actin cytoskeleton rearrangement. PMID: 19344975
  12. Northern blot analysis indicated that the human phosphohistidine phosphatase mRNA was present preferentially in heart and skeletal muscle. PMID: 12383260
  13. In the present work, we have searched for potential active site residues in the human phosphohistidine phosphatase by point mutations of conserved histidine and arginine residues to alanine. PMID: 16219293
  14. Overexpression of PHP results in increased dephosphorylation with concomitant inactivation of ACL, thus finally leading to cell damage. PMID: 18656514
  15. PHPT-1 functions to negatively regulate CD4 T cells PMID: 18796614
  16. Solution structure and catalytic mechanism of human protein histidine phosphatase 1. PMID: 18991813
  17. results suggest that an increased activity of protein histidine phosphatase (PHP) impairs neuron cellular function whereas downregulation of PHP does not PMID: 19138678

Show More

Hide All

Subcellular Location
Cytoplasm.
Protein Families
Janus family
Tissue Specificity
Expressed abundantly in heart and skeletal muscle.
Database Links

HGNC: 30033

OMIM: 610167

KEGG: hsa:29085

STRING: 9606.ENSP00000247665

UniGene: Hs.409834

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*