Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

PHPT1

Uniprot No.

Q9NRX4

Research Area

Cell Biology

Alternative Names

14 kDa phosphohistidine phosphatase; CGI 202; HSPC141; Phosphohistidine phosphatase 1; PHP14; PHP14_HUMAN; PHPT1; Protein janus A homolog; Protein janus-A homolog; Sex regulated protein janus a

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

1-125aa

Target Protein Sequence

MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

40.8kDa

Protein Length

Full Length

Tag Info

N-terminal GST-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

This Human PHPT1 recombinant protein was produced in E.coli, where the gene sequence encoding Human PHPT1 (1-125aa) was expressed with the N-terminal GST tag. The purity of this PHPT1 protein was greater than 90% by SDS-PAGE.
PHPT1 is an enzyme with its main function being the dephosphorylation of phosphorylated histidine residues. This enzyme catalyzes the removal of phosphate groups from histidine, thereby regulating signal transduction pathways associated with phosphorylation. Phosphorylation is a crucial cellular signaling mechanism that can regulate the activity, interactions, and processes of proteins. PHPT1, by dephosphorylating histidine residues, participates in maintaining the balance of intracellular phosphorylation, thus impacting multiple signaling pathways.
Some studies suggest that PHPT1 may be related to the development and progression of cancer. It can affect various biological processes associated with cancer, including cell apoptosis, proliferation, and invasion. Therefore, investigating the role of PHPT1 in cancer holds potential importance for understanding and treating cancer. In addition to its role in signaling, PHPT1 may also play a role in other physiological processes such as cell cytoskeleton remodeling, cell differentiation, and cell adhesion. Further research is ongoing to elucidate these functions.

Target Background

Function

Exhibits phosphohistidine phosphatase activity.

Gene References into Functions

In the process of assay optimization, we discovered that PHPT1 is sensitive to a reducing environment and inhibited by transition-metal ions, with one apparent Cu(II) binding site with IC50 value of 500 +/- 20 muM and two apparent Zn(II) binding sites with IC50 values of 25 +/- 1 and 490 +/- 20 muM PMID: 29630837
High PHPT1 expression is associated with cancer. PMID: 29787434
H2O2 exposure induces selective oxidation of hPHPT1 at Met95, a residue within the substrate binding region. Molecular dynamics simulations suggest that if Met95 oxidation alters hPHPT1 activity, then it will do so by altering the stability of an intermediate state. Mass spectrometry showed that H2O2-induced oxidation does not impact hPHPT1 function negatively. PMID: 27034094
PHPT1 was expressed in the epithelium of proximal tubuli and nuclei of clear-cell renal cell carcinoma tissue samples. PMID: 26537769
PHPT1 can dephosphorylate phospholysine in chemically phosphorylated histone H1 and polylysine PMID: 25574816
The specific degradation of the PHPT1 splice variant indicates that the quality control and the self-guarding of the cellular system works at two levels, first at the RNA level and proteasome level. PMID: 25450458
the histidine phosphatase, protein histidine phosphatase 1, inhibits NDPK-B-activated TRPV5 in inside/out patch experiments. PMID: 24523290
Overexpression of PHP by the use of a plasmid vector, pIRES2-AcGFP1-PHP, induced apoptosis in HUVEC PMID: 21967643
Significantly higher expression levels of PHPT1 protein were found in lung cancer samples than in normal tissues adjacent to lung cancer. PMID: 21163124
these data implicate regulatory roles for PHPT1 in a G protein-sensitive step involved in nutrient-induced insulin secretion PMID: 20501872
These results demonstrate for the first time that PHP14 may be functionally important in lung cancer cell migration and the invasion of lung cancer cells, mediated partly through modulation of actin cytoskeleton rearrangement. PMID: 19344975
Northern blot analysis indicated that the human phosphohistidine phosphatase mRNA was present preferentially in heart and skeletal muscle. PMID: 12383260
In the present work, we have searched for potential active site residues in the human phosphohistidine phosphatase by point mutations of conserved histidine and arginine residues to alanine. PMID: 16219293
Overexpression of PHP results in increased dephosphorylation with concomitant inactivation of ACL, thus finally leading to cell damage. PMID: 18656514
PHPT-1 functions to negatively regulate CD4 T cells PMID: 18796614
Solution structure and catalytic mechanism of human protein histidine phosphatase 1. PMID: 18991813
results suggest that an increased activity of protein histidine phosphatase (PHP) impairs neuron cellular function whereas downregulation of PHP does not PMID: 19138678

Hide All

Subcellular Location

Cytoplasm.

Protein Families

Janus family

Tissue Specificity

Expressed abundantly in heart and skeletal muscle.

Database Links

HGNC: 30033

OMIM: 610167

KEGG: hsa:29085

STRING: 9606.ENSP00000247665

UniGene: Hs.409834

Code	CSB-EP017942HU
Abbreviation	Recombinant Human PHPT1 protein
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human 14 kDa phosphohistidine phosphatase (PHPT1)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage