Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Cell Biology
Alternative Names
14 kDa phosphohistidine phosphatase; CGI 202; HSPC141; Phosphohistidine phosphatase 1; PHP14; PHP14_HUMAN; PHPT1; Protein janus A homolog; Protein janus-A homolog; Sex regulated protein janus a
Species
Homo sapiens (Human)
Expression Region
1-125aa
Target Protein Sequence
MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
This Human PHPT1 recombinant protein was produced in E.coli, where the gene sequence encoding Human PHPT1 (1-125aa) was expressed with the N-terminal GST tag. The purity of this PHPT1 protein was greater than 90% by SDS-PAGE.
PHPT1 is an enzyme with its main function being the dephosphorylation of phosphorylated histidine residues. This enzyme catalyzes the removal of phosphate groups from histidine, thereby regulating signal transduction pathways associated with phosphorylation. Phosphorylation is a crucial cellular signaling mechanism that can regulate the activity, interactions, and processes of proteins. PHPT1, by dephosphorylating histidine residues, participates in maintaining the balance of intracellular phosphorylation, thus impacting multiple signaling pathways.
Some studies suggest that PHPT1 may be related to the development and progression of cancer. It can affect various biological processes associated with cancer, including cell apoptosis, proliferation, and invasion. Therefore, investigating the role of PHPT1 in cancer holds potential importance for understanding and treating cancer. In addition to its role in signaling, PHPT1 may also play a role in other physiological processes such as cell cytoskeleton remodeling, cell differentiation, and cell adhesion. Further research is ongoing to elucidate these functions.