Recombinant Human AT-rich interactive domain-containing protein 4B(ARID4B),partial

In Stock
Code CSB-EP702965HU
Product Type Recombinant Protein
Size EP: USD2902
Uniprot No. Q4LE39
Abbreviation ARID4B
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence KQIDELLGKVVCVDYISLDKKKALWFPALVVCPDCSDEIAVKKDNILVRSFKDGKFTSVPRKDVHEITSDTAPKPDAVLKQAFEQALEFHKSRTIPANWKTELKEDSSSSEAEEEEEEEDDEKEKEDNSSEEEEEIEPFPEERENFLQQLYKFMEDRGTPINKRPVLGYRNLNLFKLFRLVHKLGGFDNIESGAVWKQVYQDLGIPVLNSAAGYNVKCAYKKYLYGFEEYCRSANIEFQMALPEKVVNK
Research Area Others
Source E.coli
Gene Names ARID4B
Protein Names Recommended name: AT-rich interactive domain-containing protein 4B Short name= ARID domain-containing protein 4B Alternative name(s): 180 kDa Sin3-associated polypeptide Short name= Sin3-associated polypeptide p180 Breast cancer-
Expression Region 167-415aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 32.8 kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Acts as a transcriptional repressor. May function in the assembly and/or enzymatic activity of the Sin3A corepressor complex or in mediating interactions between the complex and other regulatory complexes.
Subcellular Location Nucleus, Cytoplasm
Tissue Specificity Highly expressed in the testis and in breast, lung, colon, pancreatic and ovarian cancers. Expressed at low levels in the thymus, prostate and ovary.
Database Links

HGNC: 15550

OMIM: 609696

KEGG: hsa:51742

STRING: 9606.ENSP00000264183

UniGene: Hs.575782

Related Products

ARID4B Antibodies

ARID4B Antibodies for Homo sapiens (Human)

ARID4B Proteins

ARID4B Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.