Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
ATP synthase O subunit mitochondrial precursor; ATP synthase subunit O; ATP synthase; H+ transporting; mitochondrial F1 complex; O subunit; ATP5O; ATPO; ATPO_HUMAN; mitochondrial; Mitochondrial ATP synthase; O subunit ; Oligomycin sensitivity conferral protein; OSCP
Species
Homo sapiens (Human)
Expression Region
24-213aa
Target Protein Sequence
FAKLVRPPVQVYGIEGRYATALYSAASKQNKLEQVEKELLRVAQILKEPKVAASVLNPYVKRSIKVKSLNDITAKERFSPLTTNLINLLAENGRLSNTQGVVSAFSTMMSVHRGEVPCTVTSASPLEEATLSELKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQKLGRAMREIV
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 24-213 constitute the expression domain of recombinant Human ATP5O. This ATP5O protein is expected to have a theoretical molecular weight of 47.9 kDa. This protein is generated in a e.coli-based system. The N-terminal GST tag was fused into the coding gene segment of ATP5O, making it easier to detect and purify the ATP5O recombinant protein in the later stages of expression and purification.
The research on ATP synthase subunit O, mitochondrial (ATP5PO) covers the fields of cell biology, mitochondrial biology, and diseases related to metabolism. ATP5PO is a subunit within the mitochondria, belonging to the ATP synthase complex. One of the prominent areas of study is its crucial role in cellular energy production. Researchers focus on the role of ATP5PO in the mitochondrial respiratory chain, particularly its involvement in the formation of the ATP synthase complex and the mechanisms of catalytic reactions. Additionally, ATP5PO is associated with the pathogenesis of many diseases, especially those related to mitochondrial dysfunction and disruptions in cellular energy metabolism. Research on these diseases contributes to uncovering their causes and providing potential targets for future treatments.