Recombinant Human Aldo-keto reductase family 1 member C2 (AKR1C2)

In Stock
Code CSB-EP001543HU
Abbreviation Recombinant Human AKR1C2 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
AKR1C2
Uniprot No.
Research Area
Metabolism
Alternative Names
2-dihydrobenzene-1; 2-diol dehydrogenase; 3 alpha HSD3; 3 alpha hydroxysteroid dehydrogenase type III; 3-alpha-HSD3; AK1C2_HUMAN; AKR1C pseudo; AKR1C2; Aldo keto reductase family 1 member C2; Aldo-keto reductase family 1 member C2; BABP; Bile acid binding protein; Chlordecone reductase homolog; Chlordecone reductase homolog HAKRD; DD; DD-2; DD/BABP; DD2; DDH 2; DDH2; Dihydrodiol dehydrogenase 2; Dihydrodiol dehydrogenase/bile acid binding protein; Dihydrodiol dehydrogenase/bile acid-binding protein; FLJ53800; HAKRD; HBAB; MCDR 2; MCDR2; OTTHUMP00000044759; Pseudo chlordecone reductase; SRXY8; Trans 1 2 dihydrobenzene 1 2 diol dehydrogenase; Trans-1; Type II dihydrodiol dehydrogenase; Type III 3 alpha hydroxysteroid dehydrogenase; Type III 3-alpha-hydroxysteroid dehydrogenase
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-323aa
Target Protein Sequence
MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
52.7kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Insertion of the gene encoding the Human AKR1C2 protein (1-323aa) into a plasmid vector results in the formation of recombinant plasmid, which is then introduced into e.coli cells. Positive e.coli cells are selected relying on their ability to survive in the presence of a specific antibiotic. The e.coli cells containing the recombinant plasmid are cultured under conditions conducive to the expression of the gene of interest. A N-terminal 6xHis-SUMO tag is attached to the protein. Following expression, the recombinant Human AKR1C2 protein is isolated and purified from the cell lysate through affinity purification. The resultant recombinant Human AKR1C2 protein is analyzed using denaturing SDS-PAGE, revealing a purity greater than 90%.

Customer Reviews and Q&A

 Customer Reviews
Average Rating:
5.0 - 1 reviews

Submit a Review here

Applications : Drug treatment

Review: For the experiment with addition of constant amounts of ibuprofen (30 µM) as inhibitor of AKR1C2 no significant changes in the Km-values were observed, while the maximum velocity decreased when ibuprofen was added.

By Anonymous

 Q&A
Q:

According to the data sheet, concentration of this protein is 0.2 mg/ml. Does the indicated concentration refer to the pure protein without taq or for the whole protein (protein + tag).

A:
Thanks for your inquiry. It is for the whole protein (protein + tag).
Q:

I am interested in the product CSB-EP001543HU, and have the following questions:
Was the enzyme tested for functional experiments and if yes how is its activity and against which substance tested? As it is shipped in liquid condition I was wondering in which concentration the enzyme is in solution?

A:
Very nice to receive your inquiry.
1. We haven’t tested the activity yet so can’t 100% guarantee that it has activity. The protein we provide is full length of mature protein and purified under mild conditions, which should have activity in theory.
2. We don’t have inventory for this protein at present and need to reproduce. The general concentration of EP protein is 0.1-2mg/ml. If you have special requirement for concentration and buffer, please remark.

Target Background

Function
Cytosolic aldo-keto reductase that catalyzes the NADH and NADPH-dependent reduction of ketosteroids to hydroxysteroids. Most probably acts as a reductase in vivo since the oxidase activity measured in vitro is inhibited by physiological concentrations of NADPH. Displays a broad positional specificity acting on positions 3, 17 and 20 of steroids and regulates the metabolism of hormones like estrogens and androgens. Works in concert with the 5-alpha/5-beta-steroid reductases to convert steroid hormones into the 3-alpha/5-alpha and 3-alpha/5-beta-tetrahydrosteroids. Catalyzes the inactivation of the most potent androgen 5-alpha-dihydrotestosterone (5-alpha-DHT) to 5-alpha-androstane-3-alpha,17-beta-diol (3-alpha-diol). Also specifically able to produce 17beta-hydroxy-5alpha-androstan-3-one/5alphaDHT. May also reduce conjugated steroids such as 5alpha-dihydrotestosterone sulfate. Displays affinity for bile acids.
Gene References into Functions
  1. Curcumin treatments considerably increased the expression of AKR1C2 in prostate cancer cell lines. PMID: 29369461
  2. We identified two powerful genes in the liver cancer metastasis process, AEG-1 and AKR1C2. PMID: 26318406
  3. Identify two novel factors, AKR1C2 (positive factor) and NF1 (negative factor), as the AEG-1 downstream players in the process of metastasis in liver cancer. PMID: 26351209
  4. The endogenous HMOX1 gene but not the AKR1C2 gene is strongly repressed by Bach1 in HaCaT keratinocytes. PMID: 26244607
  5. In model cell lines of endometrial cancer, AKR1C2 and SRD5A1 have crucial roles in progesterone metabolism. PMID: 25463305
  6. Significantly higher levels of SRD5A1, AKR1C2, AKR1C3, and HSD17B10 mRNA were however found in bone metastases than in non-malignant and/or malignant prostate tissue PMID: 24244276
  7. The V54L mutation significantly decreases the 3alpha-hydroxysteroid dehydrogenase activity of DDH2 for the reduction of dihydrotestosterone. PMID: 24434280
  8. DDH2 expression might be a potential predictor and monitor of cisplatin efficacy in advanced NSCLC patients. PMID: 22534668
  9. Data suggest that modulation of AKR1C2 by glucocorticoids (dexamethasone in this study) locally modifies exposure of adipose cells to endogenous androgens; thus, AKR1C2 activation/inactivation may be involved in regional fat deposition. PMID: 22275760
  10. role of AKR1C2 in the metabolism of testosterone and progesterone via the 5beta-reductase pathway. PMID: 21521174
  11. The folding initiation mechanism of human bile acid-binding protein (BABP) has been examined by (19) F NMR. PMID: 21280124
  12. Overexpression of aldo-keto reductase 1C2 is associated with disease progression in patients with prostatic cancer PMID: 20840669
  13. We investigated associations between single nucleotide polymorphisms in genes HSD3B1, SRD5A1/2, and AKR1C2 and prostate cancer risk PMID: 20056642
  14. human ileal bile acid binding protein binds two molecules of glycocholic acid with low intrinsic affinity but an extraordinarily high degree of positive cooperativity PMID: 11854486
  15. The kinetics of 3-alpha-HSD type III indicates an ordered ternary complex mechanism characterized by allopregnanolone formation, with NAD cofactor binding before the steroid substrate and dissociating after release of the steroid product. PMID: 12416991
  16. in prostate cells AKR1C2 acts as a 3-ketosteroid reductase to eliminate 5alpha-DHT and prevents activation of the androgen receptor. PMID: 12810547
  17. Glaucomatous optic nerve head astrocytes express a higher level of 3alpha-HSD isoform AKR1C2 and its mRNA than normal astrocytes. PMID: 13678667
  18. expression and activity of type 5 17beta-hydroxysteroid dehydrogenase and type 3 3alpha-hydroxysteroid dehydrogenase in female subcutaneous tissue and omental adipose tissue and in preadipocytes PMID: 14671194
  19. Akr1c2 which is up-regulated in esophageal squamous cell carcinoma probably plays an important role in tumor development of esophagus and may be proposed as a potential molecular target treatments. PMID: 15188492
  20. metabolizes tibolone PMID: 15383625
  21. Results suggest that 17beta-hydroxysteroid dehydrogenase (17beta-HSD) type 3 might play slightly different roles in zebrafish compared with human although testosterone itself is likely to have similar functions in both organisms. PMID: 16216911
  22. human ileal bile acid binding protein has a high degree of selectivity in its interactions with glycocholate and glycochenodeoxycholate brought on by the conformation of its ternary complex PMID: 16411748
  23. The regulation of AKR1C2 by antioxidant response element suggests that AKR1C2 detoxifies products of reactive oxidant injury. PMID: 16478829
  24. continual intake of arsenic in drinking water might provoke AKR1C2 expression that could in turn induce drug resistance in bladder cancer, and AKR1C2 may have a role in development of bladder cancer PMID: 17203165
  25. Wild-type ileal BABP undergoes a slow conformational change after both bile-salt binding sites become occupied, a kinetic step that is missing in mutants that lack positive cooperativity. PMID: 17432832
  26. The inhibition of activation of the beta-catenin/TCF-signaling pathway is believed to be one mechanism by which AKR1C2 siRNA exerts a gatekeeper function during hepatocarcinogenesis. PMID: 18251165
  27. Higher mRNA levels of enzymes synthesizing and inactivating androgens are found in differentiated adipocytes, consistent with higher androgen-processing rates in these cells. PMID: 18984855
  28. The results show that several naturally occurring single nucleotide polymorphisms in AKR1C2 result in reduced enzyme activities. These variant AKR1C2 alleles may represent one factor involved in the variable degradation of dihydrotestosterone in vivo. PMID: 19258517
  29. The disulfide bridge does not modify the protein-binding stoichiometry, but has a key role in modulating recognition at both sites, inducing site selectivity for glycocholic and glycochenodeoxycholic acid. PMID: 19754879
  30. The researchers found an increased risk of breast cancer in women with AKR1C2 who carried 1 or 2 alleles and who used estrogen-progesterone therapy. PMID: 19846565

Show More

Hide All

Involvement in disease
46,XY sex reversal 8 (SRXY8)
Subcellular Location
Cytoplasm, cytosol.
Protein Families
Aldo/keto reductase family
Tissue Specificity
Expressed in fetal testes. Expressed in fetal and adult adrenal glands.
Database Links

HGNC: 385

OMIM: 600450

KEGG: hsa:1646

STRING: 9606.ENSP00000370129

UniGene: Hs.460260

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*