| Code | CSB-BP619642HU |
| MSDS | |
| Size | Pls inquire |
| Source | Baculovirus |
| Have Questions? | Leave a Message or Start an on-line Chat |
| Code | CSB-EP619642HU-B |
| MSDS | |
| Size | Pls inquire |
| Source | E.coli |
| Conjugate | Avi-tag Biotinylated E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag. |
| Have Questions? | Leave a Message or Start an on-line Chat |
There are currently no reviews for this product.
Regarding your protein CSB-EP619642HU, could you please prvide some informations for expression region,tag and sequence?
Also, I am interested in AA 1-238 of ANK3 – could you please advise on this sequence?
Also, I would prefer that the tag(s) be removed from this protein, but a GST-tag would be a tag I could work with to remove in our own lab. Could you please advise on this as well?
ERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQSFMLLKKWVTRDGKNATTDALTSVLTKINRIDIVTLLEGPIFDYGNISGTRSFADENNVFHDPVDG
MAHAASQLKKNRDLEINAEEEPEKKRKHRKRSRDRKKKSDANASYLRAARAGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDNNADVESKSGFTP