Recombinant Human Ankyrin repeat and SOCS box protein 11 (ASB11)

Code CSB-EP855501HU
Abbreviation Recombinant Human ASB11 protein
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
ASB11
Uniprot No.
Research Area
Others
Alternative Names
(ASB-11)
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-323aa
Target Protein Sequence
MEDGPVFYGFKNIFITMFATFFFFKLLIKVFLALLTHFYIVKGNRKEAARIAEEIYGGISDCWADRSPLHEAAAQGRLLALKTLIAQGVNVNLVTINRVSSLHEACLGGHVACAKALLENGAHVNGVTVHGATPLFNACCSGSAACVNVLLEFGAKAQLEVHLASPIHEAVKRGHRECMEILLANNVNIDHEVPQLGTPLYVACTYQRVDCVKKLLELGASVDHGQWLDTPLHAAARQSNVEVIHLLTDYGANLKRRNAQGKSALDLAAPKSSVEQALLLREGPPALSQLCRLCVRKCLGRACHQAIHKLHLPEPLERFLLYQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
48.3 kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant human Ankyrin repeat and SOCS box protein 11 (ASB11) production in E. coli starts with cloning the target gene (1-323aa of ASB11) into an expression vector, which is transformed into E. coli cells. The bacteria are cultured under conditions that induce protein expression. Once adequate growth is achieved, the cells are lysed to release the recombinant ASB11 protein. The protein is purified from the cell lysate through affinity chromatography. Protein purity is evaluated using SDS-PAGE, reaching over 85%.

Human ASB11, a member of the ankyrin repeat and suppressor of the cytokine signaling (SOCS) box (ASB) family, has been identified as an endoplasmic reticulum-associated ubiquitin ligase [1]. ASB11 interacts with and promotes the ubiquitination of ribophorin 1, which is involved in the glycosylation of nascent proteins [1]. ASB11 plays a crucial role in the BIK protein ubiquitination process, influencing cell survival and showing promise for anti-cancer strategies [2]. Cul5-ASB11 has been identified as the E3 ligase targeting BIK for ubiquitination and degradation, thereby determining cell fate during cellular stress [2]. Furthermore, ASB11 is a major regulator of human embryonic and adult regenerative myogenesis [3][4]. It exhibits high pan-chordate conservation, indicating fundamental functions in chordate physiology [4].

References:
[1] C. Andresen, S. Smedegaard, K. Sylvestersen, C. Svensson, D. Iglesias-Gato, G. Cazzamaliet al., Protein interaction screening for the ankyrin repeats and suppressor of cytokine signaling (socs) box (asb) family identify asb11 as a novel endoplasmic reticulum resident ubiquitin ligase, Journal of Biological Chemistry, vol. 289, no. 4, p. 2043-2054, 2014. https://doi.org/10.1074/jbc.m113.534602
[2] F. Chen, M. Huang, Y. Lin, C. Ho, S. Lin, H. Chenet al., Bik ubiquitination by the e3 ligase cul5-asb11 determines cell fate during cellular stress, The Journal of Cell Biology, vol. 218, no. 9, p. 3002-3018, 2019. https://doi.org/10.1083/jcb.201901156
[3] Y. Li, Uncovering the candidate genes related to sheep body weight using multi-trait genome-wide association analysis, Frontiers in Veterinary Science, vol. 10, 2023. https://doi.org/10.3389/fvets.2023.1206383
[4] J. Tee, M. Silva, A. Rygiel, V. Muncan, R. Bink, G. Brinket al., asb11is a regulator of embryonic and adult regenerative myogenesis, Stem Cells and Development, vol. 21, no. 17, p. 3091-3103, 2012. https://doi.org/10.1089/scd.2012.0123

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May be a substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
Gene References into Functions
  1. ASB11 is a novel endoplasmic reticulum-associated ubiquitin ligase with the ability to interact and promote the ubiquitination of Ribophorin 1, an integral protein of the oligosaccharyltransferase (OST) glycosylation complex. PMID: 24337577
Protein Families
Ankyrin SOCS box (ASB) family
Database Links

HGNC: 17186

OMIM: 300626

KEGG: hsa:140456

STRING: 9606.ENSP00000417914

UniGene: Hs.352183

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*