Recombinant Human Beta-crystallin S(CRYGS

Code CSB-EP006025HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P22914
Relevance Crystallins are the dominant structural components of the vertebrate eye lens.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Gamma-S-crystallin Gamma-crystallin S
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence SKTGTKITFYEDKNFQGRRYDCDCDCADFHTYLSRCNSIKVEGGTWAVYERPNFAGYMYILPQGEYPEYQRWMGLNDRLSSCRAVHLPSGGQYKIQIFEKGDFSGQMYETTEDCPSIMEQFHMREIHSCKVLEGVWIFYELPNYRGRQYLLDKKEYRKPIDWGAASPAVQSFRRIVE
Source E.coli
Gene Names CRYGS
Protein Names Recommended name: Beta-crystallin SAlternative name(s): Gamma-S-crystallin Gamma-crystallin S
Expression Region 2-178aa
Tag Info N-terminal GST-tagged
Mol. Weight 47.9kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Crystallins are the dominant structural components of the vertebrate eye lens.
Involvement in disease Cataract 20, multiple types (CTRCT20)
Protein Families Beta/gamma-crystallin family
Database Links

HGNC: 2417

OMIM: 116100

KEGG: hsa:1427

STRING: 9606.ENSP00000312099

UniGene: Hs.376209

Related Products

CRYGS Antibodies

CRYGS Antibodies for Human

CRYGS Proteins

CRYGS Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.