Recombinant Human Biliverdin reductase A(BLVRA)

Code CSB-EP002721HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P53004
Relevance Reduces the gamma-methene bridge of the open tetrapyrrole, biliverdin IX alpha, to bilirubin with the concomitant oxidation of a NADH or NADPH cofactor.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Biliverdin-IX alpha-reductase
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MNAEPERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVLHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKEDQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKYCCSRK
Research Area Signal Transduction
Source E.coli
Gene Names BLVRA
Protein Names Recommended name: Biliverdin reductase A Short name= BVR A EC= 1.3.1.24Alternative name(s): Biliverdin-IX alpha-reductase
Expression Region 1-296aa
Tag Info N-terminal GST-tagged
Mol. Weight 60.2kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Reduces the gamma-methene bridge of the open tetrapyrrole, biliverdin IX alpha, to bilirubin with the concomitant oxidation of a NADH or NADPH cofactor.
Involvement in disease Hyperbiliverdinemia (HBLVD)
Subcellular Location Cytoplasm
Protein Families Gfo/Idh/MocA family, Biliverdin reductase subfamily
Tissue Specificity Liver.
Database Links

HGNC: 1062

OMIM: 109750

KEGG: hsa:644

STRING: 9606.ENSP00000265523

UniGene: Hs.488143

Related Products

BLVRA Antibodies

BLVRA Antibodies for Homo sapiens (Human)

BLVRA Antibodies for Human

BLVRA Proteins

BLVRA Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.