Recombinant Human Biliverdin reductase A (BLVRA)

Code CSB-EP002721HU
Abbreviation Recombinant Human BLVRA protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
BLVRA
Uniprot No.
Research Area
Signal Transduction
Alternative Names
BIEA_HUMAN; Biliverdin IX alpha reductase; Biliverdin reductase A; Biliverdin-IX alpha-reductase; BLVR A; BLVR; Blvra; BVR A; BVR; BVRA; Zinc metalloprotein
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-296aa
Target Protein Sequence
MNAEPERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVLHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKEDQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKYCCSRK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
60.2kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Reduces the gamma-methene bridge of the open tetrapyrrole, biliverdin IX alpha, to bilirubin with the concomitant oxidation of a NADH or NADPH cofactor.
Gene References into Functions
  1. Genetic polymorphisms of the UGT1A1 promoter, specifically the T-3279G phenobarbital-responsive enhancer module and (TA)7 dinucleotide repeat, as well as the intron and coding region variants of the OATP2, HMOX1, and BLVRA genes, were significantly higher among the cases than the controls. PMID: 27943244
  2. BLVRA mRNA levels in the liver as well as in peripheral blood leukocytes are significantly higher in hepatocellular carcinoma patients most likely as a feedback mechanism to control increased oxidative stress associated with HCC progression. PMID: 27740521
  3. Data suggest that isoenzymes BVRA and BVRB play different roles in energy metabolism and in pathogenesis of abdominal obesity and hypertriglyceridemia. [REVIEW] PMID: 25726384
  4. Interactions of HO-2 with CPR and BVR, were evaluated. PMID: 25196843
  5. Activation of human biliverdin-IXalpha reductase by urea: generation of kinetically distinct forms during the unfolding pathway. PMID: 24060811
  6. These findings suggest that hBVR significantly contributes to the modulation of hypoxia-induced chemoresistance of glioblastoma cells by adjusting their cellular redox status. PMID: 24113378
  7. Increased biliverdin reductase expression is associated with multidrug resistance in leukemia. PMID: 24222129
  8. Our results suggest that patients with chronic HCV infection significantly upregulate BLVRA expression in PBL. PMID: 23536765
  9. The current study reports increased levels of both HO-1 and BVR-A in plasma from probable Alzheimer disease patients, as a result of the increased oxidative environment. PMID: 22776971
  10. rs699512 (Thr3Ala), the only common non-synonymous SNP within BLVRA, reduced the risk of essential hypertension in Kazaks. PMID: 21721974
  11. A significant increase of nitrated BVRA was demonstrated only in Alzheimer's disease and mild cognitive impairment hippocampi PMID: 21483094
  12. A homozygous BLVRA inactivating mutation is associated with the appearance of green jaundice accompanying cholestasis episodes. PMID: 21278388
  13. data support the notion that BLVRA contributes significantly to modulation of the aging process by adjusting the cellular oxidative status. PMID: 21099244
  14. An up-regulation of the biliverdin reductase-A protein levels was found in the hippocampus of the subjects with Alzheimer disease and arguably its earliest form, mild cognitive impairment. PMID: 21241799
  15. hBVR was detected in the nucleus at 1, 2, and 4 h after hypoxia (1% O(2)), at which times its kinase and reductase activities were increased. PMID: 20410444
  16. These observations support direct and indirect antioxidant properties of BVR and bilirubin and an important role for BVR and bilirubin in HO-1 conferred protection of endothelial cells. PMID: 20430037
  17. Primary spontaneous pneumothorax in smokers is associated with lung macrophage oxidative stress. The response to this condition involves HIF-1alpha-mediated induction of HO-1, BVR and H-ferritin. PMID: 20526373
  18. hBVR is a regulator of the TNF-alpha-GPBP-collagen type IV signaling cascade PMID: 20177069
  19. Bilirubin, acting as a cytoprotective antioxidant, is itself oxidized to biliverdin and then recycled by biliverdin reductase back to bilirubin. This redox cycle may constitute the principal physiologic function of bilirubin. PMID: 12456881
  20. Biliverdin reductase is a novel regulator for induction of activating transcription factor-2 and heme oxygenase-1 PMID: 14988408
  21. BVR advances the role of HO-1 in cytoprotection and affords cytoprotection independent of heme degradation PMID: 15741166
  22. hBVR activation of PKC betaII underscores its potential function in propagation of signals relayed through PKCs PMID: 17227757
  23. Results describe the activation of biliverdin-IXalpha reductase by inorganic phosphate and related anions. PMID: 17402939
  24. These findings, together with observations that si-hBVR blocked activation of ERK and Elk1 by IGF1 and prevented formation of ternary complex between MEK/ERK/hBVR, define the critical role of hBVR in ERK signaling and nuclear functions of the kinase. PMID: 18463290
  25. Case Report: A novel mutation in the biliverdin reductase-A gene combined with liver cirrhosis results in hyperbiliverdinaemia (green jaundice). PMID: 19580635
  26. Limited role for the bilirubin-biliverdin redox amplification cycle in the cellular antioxidant protection by biliverdin reductase. PMID: 19690164

Show More

Hide All

Involvement in disease
Hyperbiliverdinemia (HBLVD)
Subcellular Location
Cytoplasm.
Protein Families
Gfo/Idh/MocA family, Biliverdin reductase subfamily
Tissue Specificity
Liver.
Database Links

HGNC: 1062

OMIM: 109750

KEGG: hsa:644

STRING: 9606.ENSP00000265523

UniGene: Hs.488143

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*