Recombinant Human CD320 antigen (CD320), partial

In Stock
Code CSB-EP865096HU1
Abbreviation Recombinant Human CD320 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
CD320
Uniprot No.
Research Area
Immunology
Alternative Names
8D6; 8D6 antigen; 8D6A; CD320; CD320 antigen; CD320_HUMAN; FDC-signaling molecule 8D6; FDC-SM-8D6; TCblR; Transcobalamin receptor
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
36-231aa
Target Protein Sequence
SPLSTPTSAQAAGPSSGSCPPTKFQCRTSGLCVPLTWRCDRDLDCSDGSDEEECRIEPCTQKGQCPPPPGLPCPCTGVSDCSGGTDKKLRNCSRLACLAGELRCTLSDDCIPLTWRCDGHPDCPDSSDELGCGTNEILPEGDATTMGPPVTLESVTSLRNATTMGPPVTLESVPSVGNATSSSAGDQSGSPTAYGV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
47.6 kDa
Protein Length
Partial
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human CD320 antigen (CD320) is produced in E. coli as a partial protein covering amino acids 36-231. The protein includes an N-terminal GST tag, which helps with its solubility and purification. The product shows greater than 90% purity as confirmed by SDS-PAGE, ensuring reliable performance in experimental applications. This recombinant protein is for research use only and is not intended for human therapeutic or diagnostic applications.

CD320, also known as the transcobalamin receptor, appears to play a crucial role in how cells take up cobalamin, a form of vitamin B12. It's involved in the cobalamin transport pathway and seems essential for proper cellular metabolism. Research on CD320 may be important for understanding vitamin B12 metabolism and its implications in various biological processes, making it a valuable target in scientific studies.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant Human CD320 antigen is expressed in E. coli, a prokaryotic system that is generally unsuitable for producing functional eukaryotic membrane receptors like CD320. CD320 is a transmembrane receptor that requires precise folding, proper disulfide bond formation, glycosylation, and membrane integration for its function in transcobalamin transport. The protein is expressed as a partial extracellular fragment (36-231aa) with an N-terminal GST tag and >90% purity. However, E. coli lacks the eukaryotic chaperones, disulfide isomerases, glycosylation machinery, and membrane environment necessary for correct folding of this complex receptor. The large GST tag (~26 kDa) may significantly interfere with the native protein structure. Since activity is unverified, the protein cannot be assumed to be correctly folded or bioactive without experimental validation of its transcobalamin-binding capability.

1. Antibody Development and Validation

The recombinant CD320 fragment can serve as an effective immunogen for generating antibodies that recognize linear epitopes within the extracellular domain, even if the protein is misfolded. The high purity supports immunization protocols. However, antibodies may not recognize conformational or glycosylation-dependent epitopes of native, properly folded CD320 on human cells. Validation against endogenous CD320 from mammalian cells is essential.

2. Protein-Protein Interaction Studies

This application is high-risk without proper folding validation. While the GST tag enables technical feasibility for pull-down assays, if CD320 is misfolded (as likely in E. coli), it will not interact physiologically with true binding partners like transcobalamin. The extracellular domain requires precise conformation for specific ligand interactions. Identified interactions could be non-physiological artifacts. This application should not be pursued without confirmation of proper folding.

3. Biochemical Characterization and Binding Assays

Basic biochemical characterization is feasible, but binding assays require activity validation. If CD320 is misfolded and unglycosylated, binding studies will not reflect biological specificity. This application requires prior demonstration of proper folding and transcobalamin-binding capability using known ligands.

4. Cell-Based Functional Assays

This application is highly problematic. If the CD320 fragment is misfolded, it will not function properly in competitive binding or signaling studies. Soluble extracellular domains may act as dominant-negative mutants only if properly folded. This application requires extensive validation of proper folding and receptor function.

Final Recommendation & Action Plan

Given the high probability of misfolding in E. coli for this complex eukaryotic membrane receptor, recommend first performing comprehensive validation: 1) Biophysical characterization (circular dichroism for secondary structure, analytical ultracentrifugation for oligomeric state) to assess folding quality; 2) Functional validation of transcobalamin binding using known ligands; 3) If possible, comparison with CD320 from mammalian expression systems. Antibody development can proceed immediately as the safest application. Avoid all functional studies (interactions, binding assays, cell-based assays) until proper folding and ligand-binding activity are confirmed. For reliable CD320 research, obtain the extracellular domain from mammalian expression systems capable of proper glycosylation and folding.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for transcobalamin saturated with cobalamin (TCbl). Plays an important role in cobalamin uptake. Plasma membrane protein that is expressed on follicular dendritic cells (FDC) and mediates interaction with germinal center B cells. Functions as costimulator to promote B cell responses to antigenic stimuli; promotes B cell differentiation and proliferation. Germinal center-B (GC-B) cells differentiate into memory B-cells and plasma cells (PC) through interaction with T-cells and follicular dendritic cells (FDC). CD320 augments the proliferation of PC precursors generated by IL-10.
Gene References into Functions
  1. It has been proposed that the transcobalamin 2 receptor (TCN2R) is associated with idiopathic recurrent spontaneous abortion (RSA). The findings showed no significant association between TCN2R rs2336573 polymorphisms and the risk/protection of recurrent spontaneous abortion. PMID: 29537328
  2. the crystal structure of human holo-transcobalamin (TC) in complex with the extracellular domain of CD320, visualizing the structural basis of the TC-CD320 interaction, is reported. PMID: 27411955
  3. There was no significant difference in the expression of soluble csf CD320 between patients and controls. PMID: 28486088
  4. Although not significant when corrected for multiple testing, eight single nucleotide polymorphisms (SNPs) in two genes, transcobalamin II (TCN2) and the transcobalamin II-receptor (TCblR), were found to influence several clinical traits of cobalamin deficiency. PMID: 25657319
  5. The soluble transcobalamin receptor is present in cerebrospinal fluid and correlates to dementia-related biomarkers tau proteins and amyloid-beta. PMID: 26205293
  6. Transcobalamin II (TCN2 67A>G and TCN2 776C>G) and transcobalamin II receptor (TCblR 1104C>T) polymorphisms in Korean patients with idiopathic recurrent spontaneous abortion PMID: 24750446
  7. The high urinary concentration and the strong correlation between urinary and serum sCD320 suggests that sCD320 is filtered in the kidney. PMID: 24015289
  8. Data indicate that only the extracellular region (aa 32-229) of TCblR/CD320 is needed for transcobalamin-cobalamin (TC-Cbl) binding. PMID: 23603833
  9. Proliferating cancer cells express measurable levels of TCII and TCII-R. PMID: 24122983
  10. TCblr SNP were associated with omphalocele suggests that disruption of methylation reactions, in which folate, vitamin B12, and homocysteine play critical parts, may be a risk factor for omphalocele. PMID: 22116453
  11. Our data suggest that variation in TCblR plays a role in neural tube defect risk and that these variants may modulate cobalamin metabolism. PMID: 20577008
  12. the cell cycle associated expression of TCblR appears to be tightly regulated in synchrony with the proliferative phase of the cell cycle. PMID: 20627121
  13. Analysis of TCblR/CD320, the gene for the receptor for cellular uptake of transcobalamin-bound cobalamin, identified a homozygous single codon deletion, c.262_264GAG (p.E88del), resulting in the loss of a glutamic acid residue. PMID: 20524213
  14. Confocal microscopy of tonsil sections revealed co-localization of CD320 with CD19 and CD38 but not with CD3 indicating that germinal center B cells expressed CD320 in addition to follicular dendritic cells. PMID: 19123977
  15. This gene encodes a receptor for cellular uptake of transcobalamin-bound vitamin B12. PMID: 18779389

Show More

Hide All

Involvement in disease
Methylmalonic aciduria, transient, due to transcobalamin receptor defect (MMATC)
Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Tissue Specificity
Detected in the germinal center (GC) of lymphoid follicles (at protein level). Expressed abundantly on follicular dendritic cells (FDCs).
Database Links

HGNC: 16692

OMIM: 606475

KEGG: hsa:51293

STRING: 9606.ENSP00000301458

UniGene: Hs.558499

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*