Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-YP004954HU |
| Product Type | Recombinant Protein |
| Size | US$2010 |
| Uniprot No. | P32970 |
| Relevance | Cytokine that binds to CD27. Plays a role in T-cell activation. Induces the proliferation of costimulated T-cells and enhances the generation of cytolytic T-cells. |
| Image |
|
| Storage Buffer | Tris-based buffer,50% glycerol |
| Alias | CD27 ligand ;CD27-LTumor necrosis factor ligand superfamily member 7; CD70 |
| Species | Homo sapiens (Human) |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Sequence | QRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP |
| Research Area | Cancer |
| Source | Yeast |
| Gene Names | CD70 |
| Protein Names | Recommended name: CD70 antigen Alternative name(s): CD27 ligand Short name= CD27-L Tumor necrosis factor ligand superfamily member 7 CD_antigen= CD70 |
| Expression Region | 39-193 |
| Tag Info | N-terminal 6xHis-tagged |
| Mol. Weight | 19.1kDa |
| Protein Description | Partial |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Cytokine that binds to CD27. Plays a role in T-cell activation. Induces the proliferation of costimulated T-cells and enhances the generation of cytolytic T-cells. |
| Subcellular Location | Membrane, Single-pass type II membrane protein |
| Protein Families | Tumor necrosis factor family |
| Database Links |
HGNC: 11937 OMIM: 602840 KEGG: hsa:970 STRING: 9606.ENSP00000245903 UniGene: Hs.501497 |
I am interested in this product CSB-YP004954HU. Currently this product is supplier in a Tris buffer with 50% glycerol. Is it possible to purchase this product in PBS only?
CD70 Antibodies for Homo sapiens (Human)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA004954KA01HU | CD70 Antibody | Human,Mouse,Rat | ELISA,WB,IHC |
| CSB-PA095181 | CD70 Antibody | Human | ELISA,WB |
| CSB-PA001476 | CD70 Antibody | Human | WB,ELISA |
| CSB-PA615999 | CD70 Antibody | Human | ELISA,IHC |
| CSB-PA068483 | CD70 Antibody | Human | ELISA,IHC |
CD70 Antibodies for Human
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA08009A0Rb | CD70 Antibody | Human | ELISA, IF |
| CSB-PA08009B0Rb | CD70 Antibody, HRP conjugated | Human | ELISA |
| CSB-PA08009C0Rb | CD70 Antibody, FITC conjugated | Human | ELISA |
| CSB-PA08009D0Rb | CD70 Antibody, Biotin conjugated | Human | ELISA |
CD70 Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-EP004954HU CSB-BP004954HU CSB-MP004954HU |
Recombinant Human CD70 antigen(CD70) | E.coli Baculovirus Mammalian cell |
CD70 ELISA Kit for Homo sapiens (Human)
| Code | Product Name | Sample Types | Sensitivity |
|---|---|---|---|
| CSB-EL004954HU | Human CD70 antigen(CD70) ELISA kit | serum, plasma, tissue homogenates, cell lysates | 0.039 ng/mL |
Recombinant Human Glyceraldehyde-3-phosphate dehydrogenase(GAPDH)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Phosphoribosylformylglycinamidine synthase(PFAS),partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Rat Suppressor of cytokine signaling 3(Socs3)
Express system: Yeast
Species: Rattus norvegicus (Rat)
Recombinant Human Lymphocyte antigen 6 complex locus protein G6d(LY6G6D)
Express system: Yeast
Species: Homo sapiens (Human)
Wait!
Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.
Sign up now to get your $50 coupon for protein expression service!
We don't deal in spam.
