Recombinant Human CD70 antigen(CD70),partial

Code CSB-YP004954HU
Product Type Recombinant Protein
Size US$2010
Uniprot No. P32970
Relevance Cytokine that binds to CD27. Plays a role in T-cell activation. Induces the proliferation of costimulated T-cells and enhances the generation of cytolytic T-cells.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias CD27 ligand ;CD27-LTumor necrosis factor ligand superfamily member 7; CD70
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence QRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
Research Area Cancer
Source Yeast
Gene Names CD70
Protein Names Recommended name: CD70 antigen Alternative name(s): CD27 ligand Short name= CD27-L Tumor necrosis factor ligand superfamily member 7 CD_antigen= CD70
Expression Region 39-193
Tag Info N-terminal 6xHis-tagged
Mol. Weight 19.1kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Cytokine that binds to CD27. Plays a role in T-cell activation. Induces the proliferation of costimulated T-cells and enhances the generation of cytolytic T-cells.
Subcellular Location Membrane, Single-pass type II membrane protein
Protein Families Tumor necrosis factor family
Database Links

HGNC: 11937

OMIM: 602840

KEGG: hsa:970

STRING: 9606.ENSP00000245903

UniGene: Hs.501497

Q&A and Customer Reviews

Q&A
Q:

I am interested in this product CSB-YP004954HU. Currently this product is supplier in a Tris buffer with 50% glycerol. Is it possible to purchase this product in PBS only?

A:
Thanks for your inquiry, we could use PBS as storage buffer. Please kindly remark this requirement when sending your PO. We need to tell you in advance that we're not sure whether this protein can mantain stable in this buffer. If this protein is unstable in PBS, we will use the default buffer (Tris buffer with 50% glycerol) to deliver this protein.
Customer Reviews

Related Products

CD70 Antibodies

CD70 Antibodies for Homo sapiens (Human)

CD70 Antibodies for Human

CD70 Proteins

CD70 Proteins for Homo sapiens (Human)

CD70 ELISA Kit

CD70 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.