Recombinant Human CD70 antigen(CD70),partial

Code	CSB-YP004954HU
Size	US$1298
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Product Details
Related Products
Q&A and Customer Reviews
Target Data

Product Details

Purity	Greater than 90% as determined by SDS-PAGE.
Target Names	CD70
Uniprot No.	P32970
Research Area	Cancer
Alternative Names	CD27 ligand ;CD27-LTumor necrosis factor ligand superfamily member 7; CD70
Species	Homo sapiens (Human)
Source	Yeast
Expression Region	39-193
Target Protein Sequence	QRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight	19.1kDa
Protein Length	Extracellular Domain
Tag Info	N-terminal 6xHis-tagged
Form	Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs	Protein FAQs
Storage Condition	Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time	Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA	Please contact us to get it.
Still Have Questions?	Leave a Message or Start an on-line Chat

Q&A and Customer Reviews

■ Q&A

I am interested in this product CSB-YP004954HU. Currently this product is supplier in a Tris buffer with 50% glycerol. Is it possible to purchase this product in PBS only?

Thanks for your inquiry, we could use PBS as storage buffer. Please kindly remark this requirement when sending your PO. We need to tell you in advance that we're not sure whether this protein can mantain stable in this buffer. If this protein is unstable in PBS, we will use the default buffer (Tris buffer with 50% glycerol) to deliver this protein.

■ Customer Reviews

Submit CUSABIO Product Reciew in 2 Minutes, Win An Apple Watch!

Target Data

Function	Cytokine that binds to CD27. Plays a role in T-cell activation. Induces the proliferation of costimulated T-cells and enhances the generation of cytolytic T-cells.
Subcellular Location	Membrane, Single-pass type II membrane protein
Protein Families	Tumor necrosis factor family
Database Links	HGNC: 11937 OMIM: 602840 KEGG: hsa:970 STRING: 9606.ENSP00000245903 UniGene: Hs.501497