Recombinant Human CD70 antigen (CD70), partial (Active)

In Stock
Code CSB-MP004954HU1
Abbreviation Recombinant Human CD70 protein, partial (Active)
MSDS
Size $138
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced/non-reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human CD70 at 2 μg/ml can bind Anti-CD70 antibody, the EC50 is 2.414-3.196 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 92.5% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized Human CD70 at 2 μg/mL can bind Anti-CD70 antibody, the EC50 is 2.414-3.196 ng/mL.
Target Names
Uniprot No.
Research Area
immunity
Alternative Names
(CD27 ligand) (CD27-L)(CD27L)(CD27LG)(TNFSF7)
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
52-193aa
Target Protein Sequence
SLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP
Mol. Weight
22.7 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

CD70, a TNF superfamily member that drives CD27-mediated co-stimulatory signaling on T and B cells, plays a critical role in anti-tumor immunity and has emerged as a therapeutic target in oncology. This recombinant human CD70 (residues 52–193) is expressed in mammalian cells with an N-terminal 10xHis tag, preserving native post-translational modifications essential for receptor engagement. Functional ELISA confirms binding activity with an EC50 of 2.414–3.196 ng/mL against anti-CD70 antibody, supporting use as a coating antigen for antibody development and validation, as a positive control in CD70 detection assays, and in NF-κB signaling pathway studies downstream of CD27 activation. Endotoxin levels below 1.0 EU/μg minimize LPS-driven artifacts in immune cell-based assays, while purity exceeding 90% by SDS-PAGE satisfies the quality thresholds commonly required for in vivo tumor biology models.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cytokine which is the ligand for CD27. The CD70-CD27 pathway plays an important role in the generation and maintenance of T cell immunity, in particular during antiviral responses. Upon CD27 binding, induces the proliferation of costimulated T-cells and enhances the generation of cytolytic T-cells.
Gene References into Functions
  1. This dose-escalation phase I trial provides evidence of good tolerability of ARGX-110, pharmacokinetics, and preliminary antitumor activity at all dose levels in generally heavily pretreated patients with advanced CD70-positive malignancies PMID: 28765328
  2. Results show that CD70 promoter region methylation and expression are regulated by MBD4. Indeed, the study shows that downregulation of MBD4 contributed to overexpression and hypomethylation of the CD70 gene in CD4+ T cells from patients from systemic lupus erythematosus. PMID: 29018507
  3. CD70 mitigates atherosclerosis at least in part by modulating macrophage function. PMID: 27786334
  4. This study demonstrated that Expression of CD70 (CD27L) Is Associated With Epithelioid and Sarcomatous Features in IDH-Wild-Type Glioblastoma. PMID: 28789475
  5. CD27 is engaged by CD70 cross-presented by other AML blasts or stem/progenitor cells in a paracrine manner. PMID: 28031480
  6. human CD70-CD27 interactions therefore play a nonredundant role in T and B cell-mediated immunity, especially for protection against EBV and humoral immunity. PMID: 28011864
  7. These data demonstrate the important role of the CD70/CD27 axis in immune responses in HTLV-1 carriers and ATL patients. PMID: 26077361
  8. CD70: An emerging target in cancer immunotherapy PMID: 26213107
  9. Both monomeric and trimeric forms of CD70 were detected in tumour cell membrane fractions, whereas cytoplasmic fractions contained almost exclusively monomeric CD70 PMID: 26671750
  10. CD70 is overexpressed in systemic lupus erythematosus CD4+ T cells, but expression is not linked to the typical clinical and serological parameters associated with the disease. PMID: 24238281
  11. CD70-blocking of alphaDC1s from both controls and patients with chronic lymphocytic leukaemia had a negative influence on the production of both IL-12p70 and the Th1 cytokine IFN-gamma. PMID: 24684541
  12. CD70 acts as a functional receptor binding to soluble CD27, resulting in lymphoma progression and that immunotherapy using anti-CD70 antibody may be a potential candidate for treatment for NNKTL. PMID: 23206232
  13. The mean expression of CD70 was almost twice as high in renal cell carcinoma relative to normal kidney tissue PMID: 22401771
  14. Regulation of Langerhans cell CD70 expression is important in enhancing immunity against cutaneous epithelial pathogens and cancer. PMID: 22377764
  15. Findings suggest that demethylation of CD70 promoter region contributes to the overexpression of CD70 in CD4+ T cells and may contribute to autoimmune response in systemic sclerosis (SSc). PMID: 22306512
  16. These findings indicate that aberrant histone modifications within the TNFSF7 promoter may contribute to the development of lupus by increasing CD70 expression in CD4(+) T cells. PMID: 21865261
  17. CD70 and CD11a facilitate the survival of T and B lymphocytes and indirectly enhance the destruction of platelets in immune thrombocytopenia. PMID: 21541792
  18. data indicate that the virus-induced selective upregulation of CD70 by Langerhans cells is the critical feature that enhances their capacity to induce effector CD8+ T cell responses compared with virus-primed dermal dendritic cells that lack CD70 PMID: 21880979
  19. concluded DNA methyltransferases(DNMTs) functioned as demethylases as MBD2, while increased DNMTs and MBD2 may cause demethylation and over expression of CD70 in CD4(+) T cells, potentially contributing to the pathogenesis of immune thrombocytopenia PMID: 21550117
  20. Th1 cell-specific CD70 expression may be involved in an amplification loop for polarized Th1-type immune responses through T cell-T cell interactions. PMID: 21490618
  21. Stimulation of T cells expressing CD70-specific chimeric antigen receptors resulted in CD27 costimulation and recognition of CD70-positive tumor cell lines and primary tumor cells, as shown by IFN-gamma and IL-2 secretion and by tumor cell killing. PMID: 21304103
  22. RFX1 recruits SUV39H1 to the promoter regions of the CD11a and CD70 genes in CD4(+) T cells, thereby regulating local H3K9 tri-methylation levels. PMID: 21192791
  23. In this review, CD27 and CD70 constitute a unique pair ligand and receptor pair which can activate innate and adaptive immunity as well as regulate immunity versus tolerance. PMID: 20699361
  24. CD70 expression was significantly elevated and correlated with a decrease in CD70 promoter methylation in T4 lymphocytes from Sjogren's syndrome patients as compared to levels in controls. PMID: 20724115
  25. Epigenetic silencing of the TNFSF7 gene via hypermethylation of its proximal region may allow the benign and invasive MCF10 variants to escape immune surveillance. PMID: 20119871
  26. the CD70-CD27 interaction may play an important role in inducing effective immune responses in dendritic cell-based immunotherapy. PMID: 20201989
  27. CD70 is an important factor in the regulation of B-cell growth and differentiation by plasmacytoid dendritic cells. PMID: 20139096
  28. Data confirm previous observations of higher expression of CD70 in CD4+ T cells from patients with SLE, and suggest that increased Fyn protein content in CD4+ T cells can be associated with high SLE disease activity. PMID: 19955046
  29. Identification of CD70-mediated apoptosis of immune effector cells as a novel immune escape pathway of human glioblastoma PMID: 11980654
  30. intragraft gene expression is not a risk factor for acute cardiac allograft rejection PMID: 12009595
  31. Systemic lupus erythematosus T cells and T cells treated with DNA methyltransferase inhibitors and ERK pathway inhibitors overexpress CD70. PMID: 15188362
  32. Immunocytochemical analysis demonstrated that binding of an anti-CD70 antibody to CD70(TNFSF7), endogenously expressed on the surface of A498 and 786-O cell lines resulted in the rapid internalisation of the antibody-receptor complex. PMID: 16892042
  33. Apoptosis mediated by exposure to the CD70 secreted by tumor cells may contribute to the failure of renal cell carcinoma patients to develop an effective lymphocyte-mediated antitumor response PMID: 17132225
  34. reveal a novel role for non-Hodgkin lymphoma B cells in the development of intratumoral regulatory T cells PMID: 17615291
  35. CD27-CD70 interactions in the pathogenesis of Waldenstrom macroglobulinemia. PMID: 18216294
  36. CD70 gene was upregulated more than 1,000-fold and the enhanced expression of the CD70 molecule was confirmed by laser flow cytometry for various HTLV-1-carrying T-cell lines and primary CD4(+) T cells isolated from acute-type ATL patients. PMID: 18256142
  37. Dendritic cells matured in the presence of PGE(2) induced the expression of OX40, OX40L, and CD70 on T cells facilitating T-cell/T-cell interaction that warrant long-lasting costimulation. PMID: 19029446
  38. CD70 not only contributes to the activation of cytotoxic T cells in B cell precursor acute lymphoblastic leukemia but is a critical signal during the expansion phase of the cytotoxic T cell response. PMID: 19109206
  39. Constitutive expression of CD70 transgene is sufficient to deregulate the CD8 T cell differentiation pathway of acute infection reminiscent of events in chronic infection. PMID: 19380782
  40. Data showed that the CD70, perforin and KIR2DL4 promoters are demethylated in CD4(+)CD28(-) T cells, and that DNA methyltransferase 1 (Dnmt1) and Dnmt3a levels are decreased in this subset. PMID: 19394279

Show More

Hide All

Subcellular Location
Membrane; Single-pass type II membrane protein.
Protein Families
Tumor necrosis factor family
Database Links

HGNC: 11937

OMIM: 602840

KEGG: hsa:970

STRING: 9606.ENSP00000245903

UniGene: Hs.501497

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*