Recombinant Human Chromodomain-helicase-DNA-binding protein 4 (CHD4), partial

Discontinued
Code CSB-RP010974h
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
ATP dependent helicase CHD4; ATP-dependent helicase CHD4; CHD 4; CHD-4; CHD4; CHD4_HUMAN; Chromodomain helicase DNA binding protein 4; Chromodomain-helicase-DNA-binding protein 4; Mi 2 autoantigen 218 kDa protein; Mi 2b; Mi-2 autoantigen 218 kDa protein; Mi2 beta; Mi2-beta
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-239aa
Target Protein Sequence
MASGLGSPSPCSAGSEEEDMDALLNNSLPPPHPENEEDPEEDLSETETPKLKKKKKPKKPRDPKIPKSKRQKKERMLLCRQLGDSSGEGPEFVEEEEEVALRSDSEGSDYTPGKKKKKKLGPKKEKKSKSKRKEEEEEEDDDDDSKEPKSSAQLLEDWGMEDIDHVFSEEDYRTLTNYKAFSQFVRPLIAAKNPKIAVSKMMMVLGAKWREFSTNNPFKGSSGASVAAAAAAAVAVVES
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
31.8 KDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged and C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Component of the histone deacetylase NuRD complex which participates in the remodeling of chromatin by deacetylating histones.
Gene References into Functions
  1. that CHD4 is not only a potential prognostic biomarker for triple-negative breast cancer (TNBC) patient survival, but is also a powerful candidate in the development of new anti-cancer agents in TNBC PMID: 29305962
  2. the N-terminal part of CHD4 interacts with an unstructured A-rich region in promoter and pre-rRNA antisense "), a long noncoding RNA that is transcribed in an orientation antisense to pre-rRNA PMID: 29907651
  3. RNA interference identifies CHD4 as an essential gene in regulating breast cancer growth. PMID: 27779108
  4. Data suggest TCF19 interacts with histone 3 lysine 4 trimethylation through its plant homeodomain finger; TCF19 expression appears to regulate gluconeogenesis in hepatocytes; TCF19 interacts with CHD4 causing NuRD complex recruitment to gene promoters of enzymes involved in gluconeogenesis. (TCF19 = transcription factor 19; CHD4 = chromodomain helicase DNA binding protein 4; NuRD = nucleosome-remodeling-deacetylase) PMID: 29042441
  5. Mutation in CHD4 gene is associated with congenital heart defects. PMID: 27479907
  6. this work identifies CHD4 as an epigenetic coregulator of PAX3-FOXO1 activity, providing rational evidence for CHD4 as a potential therapeutic target in alveolar rhabdomyosarcoma. PMID: 27760049
  7. CHD4 recruits repressive chromatin proteins to sites of DNA damage repair, including DNA methyltransferases where it imposes de novo DNA methylation. At TSGs, CHD4 retention helps maintain DNA hypermethylation-associated transcriptional silencing. PMID: 28486105
  8. this study identifies the Chd4-Tbx3 axis in controlling ESC fate and a role of H2A.Z in maintaining the stability of Chd4 proteins. PMID: 28298436
  9. report provides evidence for the role of CHD4 in human development and expands an increasingly recognized group of Mendelian disorders involving chromatin remodeling and modification PMID: 27616479
  10. complex lacking CHD4 that has HDAC activity can exist as a stable species. The addition of recombinant CHD4 to this nucleosome deacetylase complex reconstitutes a NuRD complex with nucleosome remodeling activity. PMID: 27235397
  11. CHD4 plays a pivotal role in chemoresistance and the maintenance of stemness in liver cancer stem cells and is therefore a good target for the eradication of hepatocellular carcinoma. PMID: 26095183
  12. Acetyltransferase p300 collaborates with chromodomain helicase DNA-binding protein 4 (CHD4) to facilitate DNA double-strand break repair PMID: 26546801
  13. Specifically, methyl-CpG-binding domain protein 2 (MBD2) is revealed to be recruited to DNA damage sites after laser microirradiation, which was mediated through MBD domain and MBD2 C-terminus. PMID: 26827827
  14. these data build on our understanding of how CHD4-NuRD acts to regulate gene expression and participates in the DNA-damage response. PMID: 26565020
  15. CHD4 depletion modulates expression of acute myeloid leukemia cell genes that regulate tumor formation in vivo and colony formation in vitro. PMID: 26265695
  16. Also discovered a novel causative role for CHD4, a helicase involved in the histone deacetylase complex that is associated with poor clinical outcome. PMID: 26296641
  17. D140E SNP was associated with lung cancer, malignant lymphoma and rectum cancer and may interact with smoking habit to increase the risk. PMID: 25407497
  18. CHD4 modulates therapeutic response in BRCA2 mutant cancer cells. PMID: 25737278
  19. Endogenous Mta1/2 forms a complex with chromodomain helicase (Chd)4, histone deacetylases (Hdac)1/2, RbAp46/48, and Mbd3 in rat cerebellum PMID: 24991957
  20. CHD4 and HDAC1 occupy the promoters of several of these hypermethylated tumor suppressor genes and physically and functionally interact to maintain their silencing. PMID: 23708667
  21. repressive functions of MBD2-containing NuRD complexes are dependent on cooperative interactions between the major domains of CHD4 with histones and DNA and on binding of methylated DNA by MBD2 PMID: 23071088
  22. a three-dimensional structural model describing the overall shape and domain interactions of CHD4 and discuss the relevance of these for regulating the remodeling of chromatin by the NuRD complex. PMID: 22575888
  23. Concerted action of the PHD, chromo and motor domains regulates the human chromatin remodelling ATPase CHD4 PMID: 22749909
  24. Chd4 is necessary to guide proper terminal differentiation of Schwann cells; the nucleosome remodeling and deacetylase (NURD) complex is a requisite factor in timely and stable peripheral chromatin remodeling. PMID: 22302795
  25. CHD4 could bind to two H3 N-terminal tails on the same nucleosome or on two separate nucleosomes simultaneously, presenting exciting implications for the mechanism by which CHD4 and the NuRD complex could direct chromatin remodeling. PMID: 21278251
  26. PU.1 directs Mi2beta to erase an established DNase I-hypersensitive site, in an ATP-dependent reaction subsequent to PU.1 binding to chromatin, whereas ACF will not support erasure PMID: 19158090
  27. the amino-terminal and carboxyl-terminal regions of Mi-2 beta have distinct transcriptional activities and bind to BRG1 and the RET finger protein, forming a multiprotein supercomplex involved in transcriptional regulation. PMID: 14530259
  28. Mi-2beta and RFP, known to be involved in transcriptional repression in the nucleus, co-localize with MCRS1 in the nucleolus and appear to activate the rRNA transcription. PMID: 16186106
  29. The known subunits of the Mi-2/NuRD complex , their connections to signaling networks, and their association with cancer are reviewed. PMID: 17694084
  30. Data show that Mi-2/NuRD constitutes an enzymatic component of a pathway for assembly and maturation of chromatin utilized by rapidly proliferating lymphoid cells for replication of constitutive heterochromatin. PMID: 19296121
  31. The PHD2 finger plays a role in targeting of the CHD4/NuRD complex to chromatin. PMID: 19624289

Show More

Hide All

Involvement in disease
Sifrim-Hitz-Weiss syndrome (SIHIWES)
Subcellular Location
Nucleus. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome.
Protein Families
SNF2/RAD54 helicase family
Database Links

HGNC: 1919

OMIM: 603277

KEGG: hsa:1108

STRING: 9606.ENSP00000349508

UniGene: Hs.162233

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*