Recombinant Human Collectin-11(COLEC11)

Code CSB-MP861154HU
Product Type Recombinant Protein
Size Pls inquiry other sizes
Uniprot No. Q9BWP8
Abbreviation COLEC11
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Relevance Lectin that binds to various sugars including fucose and mannose. Has a higher affinity for fucose compared to mannose. Does not bind to glucose, N-acetylglucosamine and N-acetylgalactosamine. Also binds lipopolysaccharides (LPS). Involved in fundamental development serving as a guidance cue for neural crest cell migration
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

  • Based on the SEQUEST from database of Mammalian Cell host and target protein, the LC-MS/MS Analysis result of CSB-MP861154HU could indicate that this peptide derived from Mammalian Cell-expressed Homo sapiens (Human) COLEC11.

  • Based on the SEQUEST from database of Mammalian Cell host and target protein, the LC-MS/MS Analysis result of CSB-MP861154HU could indicate that this peptide derived from Mammalian Cell-expressed Homo sapiens (Human) COLEC11.

Storage Buffer Tris-based buffer,50% glycerol
Alias Collectin kidney protein 1 Short name:CL-K1
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence QPAGDDACSVQILVPGLKGDAGEKGDKGAPGRPGRVGPTGEKGDMGDKGQKGSVGRHGKIGPIGSKGEKGDSGDIGPPGPNGEPGLPCECSQLRKAIGEMDNQVSQLTSELKFIKNAVAGVRETESKIYLLVKEEKRYADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLARVFIGINDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKENM
Research Area Cell Biology
Source Mammalian cell
Gene Names COLEC11
Protein Names Recommended name: Collectin-11 Alternative name(s): Collectin kidney protein 1 Short name= CL-K1
Expression Region 26-271aa
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Product Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Mol. Weight 30.1kDa
Protein Description Full Length of Mature Protein
Still Have Questions? Leave a Message or Start an on-line Chat
Function Lectin that binds to various sugars including fucose and mannose. Has a higher affinity for fucose compared to mannose. Does not bind to glucose, N-acetylglucosamine and N-acetylgalactosamine. Also binds lipopolysaccharides (LPS). Involved in fundamental development serving as a guidance cue for neural crest cell migration (By similarity).
Involvement in disease 3MC syndrome 2 (3MC2)
Subcellular location Secreted

Related Products

COLEC11 Antibodies

COLEC11 Antibodies for Homo sapiens (Human)

COLEC11 Antibodies for Human

COLEC11 Antibodies for Danio rerio (Zebrafish) (Brachydanio rerio)

COLEC11 Proteins

COLEC11 Proteins for Bos taurus (Bovine)

COLEC11 Proteins for Gallus gallus (Chicken)

COLEC11 Proteins for Mus musculus (Mouse)

COLEC11 Proteins for Danio rerio (Zebrafish) (Brachydanio rerio)

COLEC11 Proteins for Xenopus laevis (African clawed frog)

COLEC11 Proteins for Homo sapiens (Human)

COLEC11 cDNA

COLEC11 cDNA for Gallus gallus (Chicken)

COLEC11 cDNA for Xenopus laevis (African clawed frog)

COLEC11 cDNA for Homo sapiens (Human)

COLEC11 ELISA Kit

COLEC11 ELISA Kit for Homo sapiens (Human)

COLEC11 ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.

Wait!

Join the 25,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now!

We don't deal in spam.