Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Cell Biology
Alternative Names
CL K1; CL K1 I; CL K1 II; CL K1 IIa; CL K1 IIb; CL-K1; CLK1; COL11_HUMAN; COLEC 11; COLEC11; Collectin 11; Collectin kidney I; Collectin kidney protein 1; Collectin sub family member 11; Collectin-11; Collectin11; DKFZp686N1868; MGC129470; MGC129471; MGC3279
Species
Homo sapiens (Human)
Expression Region
26-271aa
Target Protein Sequence
QPAGDDACSVQILVPGLKGDAGEKGDKGAPGRPGRVGPTGEKGDMGDKGQKGSVGRHGKIGPIGSKGEKGDSGDIGPPGPNGEPGLPCECSQLRKAIGEMDNQVSQLTSELKFIKNAVAGVRETESKIYLLVKEEKRYADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLARVFIGINDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKENM
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
To make this Recombinant Human COLEC11 protein, the COLEC11 gene was isolated at first and cloned into an expression vector. CUSABIO has built a mature recombinant protein platform. This Recombinant Human COLEC11 protein was developed in the platform. It was expressed in Mammalian cell at the region of 26-271aa of the Human COLEC11 protein. N-terminal 10xHis tag and C-terminal Myc tag was fused with the expression vector for affinity and purification purposes. The purity is 90%+ determined by SDS-PAGE.
The gene encoding collectin-11, COLEC11, is located on chromosome 2p25.3 (OMIM 612502) and comprises 7 exons that transcribe the canonical protein. COLEC11 variability was shown to interfere with expression and also with the binding of calcium and carbohydrates, possibly affecting protein folding. Collectin-11 shows a strong binding affinity to fucose-proteins, as found in the Tc-85 protein family, expressed on the surface of T. cruzi metacyclic trypomastigotes. Those proteins are involved in the entry of the parasite to host cells. In addition, collectin-11 is structurally similar to MBL and it has been shown that both MBL levels and MBL2 genetic variants were associated with disease susceptibility and pathophysiology of CD. Considering these observations, collectin-11 plasma levels and COLEC11 variants in exon 7 were assessed to investigate their potential role in the chronic CD. Moreover, on account of the interaction between collectin-11 and MASPs for complement activation, gene-gene interaction between COLEC11 and MASP2 was assessed to evaluate the additive genetic effect of the two loci and their role in the pathophysiology of this chronic disease.