Recombinant Human 11-beta-hydroxysteroid dehydrogenase type 2 (HSD11B2)

In Stock
Code CSB-YP010765HU
Abbreviation Recombinant Human HSD11B2 protein
MSDS
Size $250
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
11 beta HSD2; 11 beta hydroxysteroid dehydrogenase type 2; 11 DH2; 11-beta-HSD2; 11-beta-hydroxysteroid dehydrogenase type 2; 11-DH2; AME; AME1; Corticosteroid 11 beta dehydrogenase isozyme 2; Corticosteroid 11-beta-dehydrogenase isozyme 2; DHI2_HUMAN; HSD11B2; HSD11K; HSD2; Hydroxysteroid 11 beta dehydrogenase 2; Hydroxysteroid 11 beta dehydrogenase isoenzyme 2; NAD dependent 11 beta hydroxysteroid dehydrogenase ; NAD-dependent 11-beta-hydroxysteroid dehydrogenase; SDR9C3; Short chain dehydrogenase/reductase family 9C; member 3
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
1-405aa
Target Protein Sequence
MERWPWPSGGAWLLVAARALLQLLRSDLRLGRPLLAALALLAALDWLCQRLLPPPAALAVLAAAGWIALSRLARPQRLPVATRAVLITGCDSGFGKETAKKLDSMGFTVLATVLELNSPGAIELRTCCSPRLRLLQMDLTKPGDISRVLEFTKAHTTSTGLWGLVNNAGHNEVVADAELSPVATFRSCMEVNFFGALELTKGLLPLLRSSRGRIVTVGSPAGDMPYPCLGAYGTSKAAVALLMDTFSCELLPWGVKVSIIQPGCFKTESVRNVGQWEKRKQLLLANLPQELLQAYGKDYIEHLHGQFLHSLRLAMSDLTPVVDAITDALLAARPRRRYYPGQGLGLMYFIHYYLPEGLRRRFLQAFFISHCLPRALQPGQPGTTPPQDAAQDPNLSPGPSPAVAR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
46.1kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human 11-beta-hydroxysteroid dehydrogenase type 2 (HSD11B2) is produced in yeast and contains the complete protein sequence (1-405 amino acids) with an N-terminal 6xHis-tag that makes purification straightforward. SDS-PAGE analysis confirms the protein reaches greater than 90% purity, which appears to make it well-suited for research applications that demand high-quality reagents.

HSD11B2 serves a key function in glucocorticoid metabolism. It converts active cortisol into its inactive form, cortisone. The enzyme seems particularly important for maintaining mineralocorticoid receptor specificity—it does this by regulating local cortisol concentrations, which in turn affects sodium balance and blood pressure control. Research into this enzyme may prove essential for understanding corticosteroid-related pathways and associated disorders.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the folding state and bioactivity of this recombinant HSD11B2 protein are unknown and must be considered highly uncertain. HSD11B2 is an enzyme that requires precise folding for its catalytic activity, correct binding of its NAD+ cofactor, and formation of its active site. While expression in a yeast system (a eukaryotic host) is more favorable than bacteria for producing complex eukaryotic proteins and may support disulfide bond formation, there is no guarantee of correct folding or activity. The presence of an N-terminal 6xHis tag could potentially interfere with the protein's N-terminal region or its oligomerization. The >90% purity indicates a clean preparation, but does not confirm a functional enzyme. Therefore, applications that depend on the protein's specific enzymatic activity or native conformation are speculative without validation.

1. Protein-Protein Interaction Studies Using His-Tag Pull-Down Assays

The N-terminal 6xHis-tag allows this recombinant HSD11B2 to be immobilized for pull-down experiments. However, the utility of these assays for identifying biological interaction partners is entirely contingent on the protein being correctly folded. If the protein is misfolded and inactive, it will not present the correct surfaces for specific interactions with cofactors or regulatory proteins. Any interactions identified could be non-specific artifacts of the misfolded state. This approach is not recommended for elucidating regulatory mechanisms without first confirming the protein's native structure.

2. Antibody Development and Validation

This full-length recombinant HSD11B2 protein is suitable for use as an immunogen to generate antibodies. The high purity is adequate for immunization. However, it is critical to understand that antibodies generated will be primarily against the linear epitopes of this recombinant HSD11B2 protein. Their ability to recognize the natively folded, active HSD11B2 enzyme in human tissues is not guaranteed and must be empirically validated. The protein is reliable for developing antibodies for techniques like Western blotting, but its suitability for functional studies (e.g., blocking activity) is uncertain.

3. Biochemical Characterization and Cofactor Binding Studies

This recombinant HSD11B2 protein is a starting point for biochemical characterization. However, the entire premise of studying "cofactor requirements" and "binding studies with NAD+" is invalid without first confirming the protein's enzymatic activity. The logical first step is to perform an enzymatic activity assay. If active, then studies on cofactor kinetics and stability can be pursued meaningfully. If inactive, any binding data would be uninterpretable.

4. Structural Biology Applications for Crystallization Screening

The high purity and full-length nature of the recombinant HSD11B2 protein make it suitable for initial crystallization trials. However, success is entirely dependent on the protein being homogeneous and correctly folded. A misfolded HSD11B2 protein is highly unlikely to yield diffractable crystals. The His-tag can be used for purification but may need to be removed to facilitate crystallization, as flexible tags can hinder crystal packing. This application is a low-probability, high-reward endeavor that can be attempted but should not be the primary use without activity confirmation.

Final Recommendation & Action Plan

The immediate and essential first step is to experimentally validate the enzymatic activity of this recombinant HSD11B2 protein using a standard dehydrogenase activity assay (e.g., measuring the conversion of corticosterone to 11-dehydrocorticosterone). The outcome of this test is critical and dictates all subsequent applications: a positive result would justify and enable functional studies in Applications 1 (interactions), 3 (biochemistry/cofactor binding), and 4 (crystallography). A negative result would limit its reliable use to Application 2 (antibody production for linear epitopes) and would necessitate troubleshooting of the expression and purification protocol to obtain an active protein. Therefore, the activity assay is a non-negotiable prerequisite before investing significant resources in most proposed applications.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalyzes the conversion of cortisol to the inactive metabolite cortisone. Modulates intracellular glucocorticoid levels, thus protecting the nonselective mineralocorticoid receptor from occupation by glucocorticoids.
Gene References into Functions
  1. Sequence defects (16q22.1) cause Monogenic Hypertension Syndrome in children (with muscle weakness in severe forms)as result of apparent mineralocorticoid excess. PMID: 29229168
  2. High systemic 11beta-HSD2 activity in preeclampsia but not in intrauterine growth retardation suggests an increased cortisol deactivation in maternal tissue in preeclampsia rather than in the placenta. PMID: 29523277
  3. Analyses demonstrated a trend in the association between maternal trait anxiety and depression symptoms with placental gene expression of NR3C1. We found a significant interaction with maternal ethnicity. In Caucasians only, prenatal trait anxiety and depressive symptoms were associated with an increase in placental NR3C1 expression, and prenatal life events were associated with a down regulation of HSD11B2 PMID: 29100173
  4. mutations that allow the formation of an inactive dimer, alter substrate/coenzyme binding, or impair structural stability of HSD11B2 yield severe apparent mineralocorticoid excess (AME). In contrast, mutations that cause an indirect disruption of substrate binding or mildly alter intramolecular interactions result in type 2 AME. PMID: 29229831
  5. Six sequence variations were observed. Four mutations were indicated in the coding region of HSD11B2 and the other two in 3'-UTR. Two SNPs: c.468C > A and c.534G > A were found to be in total disequilibrium. High variability in HSD11B2 sequence was indicated in the study population, but the relevance of observed SNPs to gestational hypertension or pre-eclampsia development was not confirmed. PMID: 27686600
  6. the role of 11beta-HSD2 in determining birth weight PMID: 28502862
  7. SUMOylation of 11beta-HSD2 at residue K266 modulates cortisol-mediated MR nuclear translocation independently of effects on transactivation. PMID: 28938454
  8. 11beta-HSD2 activity is not reduced in patients with drug resistant hypertension, suggesting that variation in the conversion of cortisol to cortisone does not contribute to development of antihypertensive treatment resistance. PMID: 28180242
  9. abundantly localized in syncytial layer of the chorionic villi and the decidual epithelium PMID: 27697223
  10. The data demonstrate for the first time that 11b- HSD2 plays a key role in the pathophysiology of malignant epidermal cells. PMID: 28797028
  11. DNA sequence analysis of affected members of Apparent mineralocorticoid excess family revealed homozygous c.799A>G mutations within exon 4 of HSD11B2, corresponding to a p.T267A mutation of 11betaHSD2. PMID: 27526338
  12. activation of Hedgehog signaling is crucial for the upregulation and maintenance of 11beta-HSD2 expression in placenta PMID: 27379371
  13. Rac1 GTPase regulates 11beta-HSD2 expression, mineralocorticoid receptor activation, and mineralocorticoid receptor-mediated pro-fibrotic signaling. PMID: 28320863
  14. enhancer of zeste homolog 2 (EZH2) accounts for the silence of 11beta-HSD2 expression via trimethylation of histone H3 lysine 27 at the promoter of the 11beta-HSD2 gene. PMID: 28302719
  15. Sensitivity to glucocorticoids did not appear to be mediated by changes in the expression of the beta variant of the glucocorticoid receptor or the 11-beta hydroxysteroid dehydrogenase 2 isozyme. PMID: 26963327
  16. Review of the role of HSD11B2 in pregnancy complications, fetal diseases, and later life morbidity. PMID: 27018008
  17. Since increased DNA methylation in HSD11B2 and FKBP5 are seen in a minority of bisulfite sequencing clones, these epigenetic changes, and functional consequences, may affect subpopulations of placental cells. PMID: 27013342
  18. significant positive correlation between DNA methylation of 11beta-HSD2 CpG 1 in infants and maternal sensitivity. PMID: 26822444
  19. The 11beta-HSD2 expression decreased in pre-eclamptic women of Chinese Han ethnicity, but was not interrelated with the promoter methylation status. PMID: 25331012
  20. zearalenone is a selective inhibitor of HSD11B2, implying that this agent may cause excessive glucocorticoid action in local tissues such as kidney and placentas. PMID: 26798634
  21. Infants with the high-risk neurobehavioral profile showed more methylation than infants with the low-risk neurobehavioral profile at CpG3 for NR3C1 and less methylation of CpG3 for HSD11B2. PMID: 26585459
  22. The CA-repeat length did not influence BP levels or serum F/E ratios in pediatric subjects. However, the serum F/E ratio was associated with BP, suggesting a role of 11betaHSD2 in mineralocorticoid hypertension. PMID: 25907225
  23. growth potential of fetus related to the 11beta-HSD2 expression in the placenta, and 11beta-HSD2 expression related to the trace metals status of the mother PMID: 26462907
  24. maternal depression and anxiety may impact on fetal programming by down-regulating HSD11B2, and antidepressant treatment alone is unlikely to protect against this effect. PMID: 26593902
  25. Data show that glucocorticoid response genes NR3C1, ADCYAP1R1 and HSD11B2 were relatively hypomethylated whereas FKBP5 was hypermethylated. PMID: 26343289
  26. No interaction was found between HSD11B2 and exposure during pregnancy, but individuals with the A allele of rs5479 had an increased risk of schizophrenia after exposure at age 3-9 years PMID: 26115144
  27. 11betaHSD2 inhibition suppressed lung tumor growth and invasion in association with increased tissue active glucocorticoid levels, decreased COX-2 expression, inhibition of ERK and mTOR signaling pathways. PMID: 26011146
  28. A novel HSD11B2 functional mutation accounting for an Ala221Gly substitution causes Apparent mineralocorticoid excess. The hypertension phenotype is also epigenetically modulated by HSD11B2 methylation in subjects heterozygous for the mutation PMID: 26126204
  29. infants with low NR3C1 methylation but high HSD11B2 methylation had lower excitability scores; those with high NR3C1 methylation but low HSD11B2 methylation had more asymmetrical reflexes PMID: 25459891
  30. Insulin reduced the 11beta-HSD2 activity in cancer colon cell lines (HCT116, SW620 and HT-29) at the transcriptional level, in a time and dose dependent manner. PMID: 25133511
  31. Preeclampsia reduces methylation level at fetal HSD11B2 promoter. PMID: 25200528
  32. hypertensivesThe 11bHSD2 polymorphism-derived allele frequency was very low, completely absent in controls and no homozygous mutants were found PMID: 25572238
  33. variants of HSD11B2 may be not a cause of obesity. PMID: 24729284
  34. The inverse association of offspring 11beta-HSD-2 activity with maternal age at Holocaust exposure is consistent with the influence of glucocorticoid programming. PMID: 24971590
  35. No correlation was observed between the placental gene expression of 11bHSD-2 and infantile growth at 10 months of age. PMID: 24147632
  36. Results show a link between the site-specific methylation of placental 11beta-hydroxysteroid dehydrogenase (HSD11B2) promoter and the development of intrauterine growth restriction (IUGR). PMID: 24129435
  37. the downregulation of 11HSD2 gene expression is a typical feature of the development of colorectal polypous lesions and their transformation into colorectal adenocarcinoma PMID: 24189979
  38. fetal HSD11B2[CA]n microsatellite polymorphism of the HSD11B2 gene in healthy uncomplicated human pregnancy is associated with maternal cortisol concentration PMID: 24685985
  39. placental 11bHSD2 expression is significantly reduced in pregnancies complicated by intrahepatic cholestasis of pregnancy. PMID: 24262137
  40. Increased glucocorticoid exposure as a consequence of reduced 11beta-hydroxysteroid dehydrogenase type 2 activity is likely to be a critical determinant of growth in early life PMID: 24517145
  41. analysis of placental 11-B hydroxysteroid dehydrogenase methylation patterns and how they relate to prenatal socioeconomic adversity PMID: 24040322
  42. Data suggest that placental HSD11B2 mRNA expression during prolonged pregnancy is higher in women who do not respond to induction of labor than in responders and in women who enter labor spontaneously. PMID: 24054540
  43. Data suggest that expression of HSD11B2 in placenta/trophoblast cells is regulated, in part, via the ERK1/2 (mitogen-activated protein kinases 3/1) signaling pathway; this pathway mediates cadmium chloride repression of placental HSD11B2 activity. PMID: 23966319
  44. HSD11B2 CA-repeat genotype is not associated with hypertension itself, but with renal sodium excretion, probably through salt intake/appetite. PMID: 23446772
  45. 11beta-HSD2 expression can be modulated by PPARalpha and PPARgamma in placental trophoblasts through Sp-1 PMID: 24169559
  46. HSD11B1 and HSD11B2 single nucleotide polymorphisms in hypertensive disorders in pregnancy. PMID: 23659736
  47. Genotyping indicated no hypertension related mutations in the coding region and short introns of HSD11B2 PMID: 23303402
  48. genetic association studies in Japan: Data suggest that in normal subjects total CA-repeat length in HSD11B2 is negatively correlated with insulin secretion; subjects with longer CA repeats in HSD11B2 are more susceptible to glucose intolerance. PMID: 23357976
  49. Data suggest that interaction of p300/Sp1 (lysine acetyltransferase 2B/transcription factor Sp1) with HSD11B2 promoter plays crucial role in histone acetylation in syncytiotrophoblasts; these interactions may be important in placentation. PMID: 23714681
  50. cortisol/cortisone ratio increased with age, but cortisone decreased, suggesting decrease in 11beta-HSD2 activity. Results suggest that cortisol-mediated activation of mineralocorticoid receptor may explain blood pressure increase in elderly subjects. PMID: 23443726

Show More

Hide All

Involvement in disease
Apparent mineralocorticoid excess (AME)
Subcellular Location
Microsome. Endoplasmic reticulum.
Protein Families
Short-chain dehydrogenases/reductases (SDR) family
Tissue Specificity
Expressed in kidney, pancreas, prostate, ovary, small intestine and colon. At midgestation, expressed at high levels in placenta and in fetal kidney and, at much lower levels, in fetal lung and testis.
Database Links

HGNC: 5209

OMIM: 218030

KEGG: hsa:3291

STRING: 9606.ENSP00000316786

UniGene: Hs.1376

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*