Recombinant Human Corticosteroid 11-beta-dehydrogenase isozyme 2(HSD11B2)

Code CSB-YP010765HU
Product Type Recombinant Protein
Size US$2010
Uniprot No. P80365
Relevance Catalyzes the conversion of cortisol to the inactive metabolite cortisone. Modulates intracellular glucocorticoid levels, thus protecting the nonselective mineralocorticoid receptor from occupation by glucocorticoids.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias 11-beta-hydroxysteroid dehydrogenase type 2 ;11-DH2 ;11-beta-HSD211-beta-hydroxysteroid dehydrogenase type II ;-HSD11 type IINAD-dependent 11-beta-hydroxysteroid dehydrogenase ;11-beta-HSDShort chain dehydrogenase/reductase family 9C member 3
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MERWPWPSGGAWLLVAARALLQLLRSDLRLGRPLLAALALLAALDWLCQRLLPPPAALAVLAAAGWIALSRLARPQRLPVATRAVLITGCDSGFGKETAKKLDSMGFTVLATVLELNSPGAIELRTCCSPRLRLLQMDLTKPGDISRVLEFTKAHTTSTGLWGLVNNAGHNEVVADAELSPVATFRSCMEVNFFGALELTKGLLPLLRSSRGRIVTVGSPAGDMPYPCLGAYGTSKAAVALLMDTFSCELLPWGVKVSIIQPGCFKTESVRNVGQWEKRKQLLLANLPQELLQAYGKDYIEHLHGQFLHSLRLAMSDLTPVVDAITDALLAARPRRRYYPGQGLGLMYFIHYYLPEGLRRRFLQAFFISHCLPRALQPGQPGTTPPQDAAQDPNLSPGPSPAVAR
Research Area Cancer
Source Yeast
Gene Names HSD11B2
Protein Names Recommended name: Corticosteroid 11-beta-dehydrogenase isozyme 2 EC= 1.1.1.- Alternative name(s): 11-beta-hydroxysteroid dehydrogenase type 2 Short name= 11-DH2 Short name= 11-beta-HSD2 11-beta-hydroxysteroid dehydrogenase
Expression Region 1-405aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 46.1kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Catalyzes the conversion of cortisol to the inactive metabolite cortisone. Modulates intracellular glucocorticoid levels, thus protecting the nonselective mineralocorticoid receptor from occupation by glucocorticoids.
Involvement in disease Apparent mineralocorticoid excess (AME)
Subcellular Location Microsome, Endoplasmic reticulum
Protein Families Short-chain dehydrogenases/reductases (SDR) family
Tissue Specificity Expressed in kidney, pancreas, prostate, ovary, small intestine and colon. At midgestation, expressed at high levels in placenta and in fetal kidney and, at much lower levels, in fetal lung and testis (PubMed:8530071).
Database Links

HGNC: 5209

OMIM: 218030

KEGG: hsa:3291

STRING: 9606.ENSP00000316786

UniGene: Hs.1376

Related Products

HSD11B2 Antibodies

HSD11B2 Antibodies for Homo sapiens (Human)

HSD11B2 Antibodies for Human

HSD11B2 Proteins

HSD11B2 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.