Recombinant Human Corticosteroid 11-beta-dehydrogenase isozyme 2(HSD11B2)

Code CSB-YP010765HU
Size US$1298
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names HSD11B2
Uniprot No. P80365
Research Area Cancer
Alternative Names 11 beta HSD2; 11 beta hydroxysteroid dehydrogenase type 2; 11 DH2; 11-beta-HSD2; 11-beta-hydroxysteroid dehydrogenase type 2; 11-DH2; AME; AME1; Corticosteroid 11 beta dehydrogenase isozyme 2; Corticosteroid 11-beta-dehydrogenase isozyme 2; DHI2_HUMAN; HSD11B2; HSD11K; HSD2; Hydroxysteroid 11 beta dehydrogenase 2; Hydroxysteroid 11 beta dehydrogenase isoenzyme 2; NAD dependent 11 beta hydroxysteroid dehydrogenase ; NAD-dependent 11-beta-hydroxysteroid dehydrogenase; SDR9C3; Short chain dehydrogenase/reductase family 9C; member 3
Species Homo sapiens (Human)
Source Yeast
Expression Region 1-405aa
Target Protein Sequence MERWPWPSGGAWLLVAARALLQLLRSDLRLGRPLLAALALLAALDWLCQRLLPPPAALAVLAAAGWIALSRLARPQRLPVATRAVLITGCDSGFGKETAKKLDSMGFTVLATVLELNSPGAIELRTCCSPRLRLLQMDLTKPGDISRVLEFTKAHTTSTGLWGLVNNAGHNEVVADAELSPVATFRSCMEVNFFGALELTKGLLPLLRSSRGRIVTVGSPAGDMPYPCLGAYGTSKAAVALLMDTFSCELLPWGVKVSIIQPGCFKTESVRNVGQWEKRKQLLLANLPQELLQAYGKDYIEHLHGQFLHSLRLAMSDLTPVVDAITDALLAARPRRRYYPGQGLGLMYFIHYYLPEGLRRRFLQAFFISHCLPRALQPGQPGTTPPQDAAQDPNLSPGPSPAVAR
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 46.1kDa
Protein Length Full Length
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Catalyzes the conversion of cortisol to the inactive metabolite cortisone. Modulates intracellular glucocorticoid levels, thus protecting the nonselective mineralocorticoid receptor from occupation by glucocorticoids.
Gene References into Functions
  1. Sequence defects (16q22.1) cause Monogenic Hypertension Syndrome in children (with muscle weakness in severe forms)as result of apparent mineralocorticoid excess. PMID: 29229168
  2. High systemic 11beta-HSD2 activity in preeclampsia but not in intrauterine growth retardation suggests an increased cortisol deactivation in maternal tissue in preeclampsia rather than in the placenta. PMID: 29523277
  3. Analyses demonstrated a trend in the association between maternal trait anxiety and depression symptoms with placental gene expression of NR3C1. We found a significant interaction with maternal ethnicity. In Caucasians only, prenatal trait anxiety and depressive symptoms were associated with an increase in placental NR3C1 expression, and prenatal life events were associated with a down regulation of HSD11B2 PMID: 29100173
  4. mutations that allow the formation of an inactive dimer, alter substrate/coenzyme binding, or impair structural stability of HSD11B2 yield severe apparent mineralocorticoid excess (AME). In contrast, mutations that cause an indirect disruption of substrate binding or mildly alter intramolecular interactions result in type 2 AME. PMID: 29229831
  5. Six sequence variations were observed. Four mutations were indicated in the coding region of HSD11B2 and the other two in 3'-UTR. Two SNPs: c.468C > A and c.534G > A were found to be in total disequilibrium. High variability in HSD11B2 sequence was indicated in the study population, but the relevance of observed SNPs to gestational hypertension or pre-eclampsia development was not confirmed. PMID: 27686600
  6. the role of 11beta-HSD2 in determining birth weight PMID: 28502862
  7. SUMOylation of 11beta-HSD2 at residue K266 modulates cortisol-mediated MR nuclear translocation independently of effects on transactivation. PMID: 28938454
  8. 11beta-HSD2 activity is not reduced in patients with drug resistant hypertension, suggesting that variation in the conversion of cortisol to cortisone does not contribute to development of antihypertensive treatment resistance. PMID: 28180242
  9. abundantly localized in syncytial layer of the chorionic villi and the decidual epithelium PMID: 27697223
  10. The data demonstrate for the first time that 11b- HSD2 plays a key role in the pathophysiology of malignant epidermal cells. PMID: 28797028
  11. DNA sequence analysis of affected members of Apparent mineralocorticoid excess family revealed homozygous c.799A>G mutations within exon 4 of HSD11B2, corresponding to a p.T267A mutation of 11betaHSD2. PMID: 27526338
  12. activation of Hedgehog signaling is crucial for the upregulation and maintenance of 11beta-HSD2 expression in placenta PMID: 27379371
  13. Rac1 GTPase regulates 11beta-HSD2 expression, mineralocorticoid receptor activation, and mineralocorticoid receptor-mediated pro-fibrotic signaling. PMID: 28320863
  14. enhancer of zeste homolog 2 (EZH2) accounts for the silence of 11beta-HSD2 expression via trimethylation of histone H3 lysine 27 at the promoter of the 11beta-HSD2 gene. PMID: 28302719
  15. Sensitivity to glucocorticoids did not appear to be mediated by changes in the expression of the beta variant of the glucocorticoid receptor or the 11-beta hydroxysteroid dehydrogenase 2 isozyme. PMID: 26963327
  16. Review of the role of HSD11B2 in pregnancy complications, fetal diseases, and later life morbidity. PMID: 27018008
  17. Since increased DNA methylation in HSD11B2 and FKBP5 are seen in a minority of bisulfite sequencing clones, these epigenetic changes, and functional consequences, may affect subpopulations of placental cells. PMID: 27013342
  18. significant positive correlation between DNA methylation of 11beta-HSD2 CpG 1 in infants and maternal sensitivity. PMID: 26822444
  19. The 11beta-HSD2 expression decreased in pre-eclamptic women of Chinese Han ethnicity, but was not interrelated with the promoter methylation status. PMID: 25331012
  20. zearalenone is a selective inhibitor of HSD11B2, implying that this agent may cause excessive glucocorticoid action in local tissues such as kidney and placentas. PMID: 26798634
  21. Infants with the high-risk neurobehavioral profile showed more methylation than infants with the low-risk neurobehavioral profile at CpG3 for NR3C1 and less methylation of CpG3 for HSD11B2. PMID: 26585459
  22. The CA-repeat length did not influence BP levels or serum F/E ratios in pediatric subjects. However, the serum F/E ratio was associated with BP, suggesting a role of 11betaHSD2 in mineralocorticoid hypertension. PMID: 25907225
  23. growth potential of fetus related to the 11beta-HSD2 expression in the placenta, and 11beta-HSD2 expression related to the trace metals status of the mother PMID: 26462907
  24. maternal depression and anxiety may impact on fetal programming by down-regulating HSD11B2, and antidepressant treatment alone is unlikely to protect against this effect. PMID: 26593902
  25. Data show that glucocorticoid response genes NR3C1, ADCYAP1R1 and HSD11B2 were relatively hypomethylated whereas FKBP5 was hypermethylated. PMID: 26343289
  26. No interaction was found between HSD11B2 and exposure during pregnancy, but individuals with the A allele of rs5479 had an increased risk of schizophrenia after exposure at age 3-9 years PMID: 26115144
  27. 11betaHSD2 inhibition suppressed lung tumor growth and invasion in association with increased tissue active glucocorticoid levels, decreased COX-2 expression, inhibition of ERK and mTOR signaling pathways. PMID: 26011146
  28. A novel HSD11B2 functional mutation accounting for an Ala221Gly substitution causes Apparent mineralocorticoid excess. The hypertension phenotype is also epigenetically modulated by HSD11B2 methylation in subjects heterozygous for the mutation PMID: 26126204
  29. infants with low NR3C1 methylation but high HSD11B2 methylation had lower excitability scores; those with high NR3C1 methylation but low HSD11B2 methylation had more asymmetrical reflexes PMID: 25459891
  30. Insulin reduced the 11beta-HSD2 activity in cancer colon cell lines (HCT116, SW620 and HT-29) at the transcriptional level, in a time and dose dependent manner. PMID: 25133511
  31. Preeclampsia reduces methylation level at fetal HSD11B2 promoter. PMID: 25200528
  32. hypertensivesThe 11bHSD2 polymorphism-derived allele frequency was very low, completely absent in controls and no homozygous mutants were found PMID: 25572238
  33. variants of HSD11B2 may be not a cause of obesity. PMID: 24729284
  34. The inverse association of offspring 11beta-HSD-2 activity with maternal age at Holocaust exposure is consistent with the influence of glucocorticoid programming. PMID: 24971590
  35. No correlation was observed between the placental gene expression of 11bHSD-2 and infantile growth at 10 months of age. PMID: 24147632
  36. Results show a link between the site-specific methylation of placental 11beta-hydroxysteroid dehydrogenase (HSD11B2) promoter and the development of intrauterine growth restriction (IUGR). PMID: 24129435
  37. the downregulation of 11HSD2 gene expression is a typical feature of the development of colorectal polypous lesions and their transformation into colorectal adenocarcinoma PMID: 24189979
  38. fetal HSD11B2[CA]n microsatellite polymorphism of the HSD11B2 gene in healthy uncomplicated human pregnancy is associated with maternal cortisol concentration PMID: 24685985
  39. placental 11bHSD2 expression is significantly reduced in pregnancies complicated by intrahepatic cholestasis of pregnancy. PMID: 24262137
  40. Increased glucocorticoid exposure as a consequence of reduced 11beta-hydroxysteroid dehydrogenase type 2 activity is likely to be a critical determinant of growth in early life PMID: 24517145
  41. analysis of placental 11-B hydroxysteroid dehydrogenase methylation patterns and how they relate to prenatal socioeconomic adversity PMID: 24040322
  42. Data suggest that placental HSD11B2 mRNA expression during prolonged pregnancy is higher in women who do not respond to induction of labor than in responders and in women who enter labor spontaneously. PMID: 24054540
  43. Data suggest that expression of HSD11B2 in placenta/trophoblast cells is regulated, in part, via the ERK1/2 (mitogen-activated protein kinases 3/1) signaling pathway; this pathway mediates cadmium chloride repression of placental HSD11B2 activity. PMID: 23966319
  44. HSD11B2 CA-repeat genotype is not associated with hypertension itself, but with renal sodium excretion, probably through salt intake/appetite. PMID: 23446772
  45. 11beta-HSD2 expression can be modulated by PPARalpha and PPARgamma in placental trophoblasts through Sp-1 PMID: 24169559
  46. HSD11B1 and HSD11B2 single nucleotide polymorphisms in hypertensive disorders in pregnancy. PMID: 23659736
  47. Genotyping indicated no hypertension related mutations in the coding region and short introns of HSD11B2 PMID: 23303402
  48. genetic association studies in Japan: Data suggest that in normal subjects total CA-repeat length in HSD11B2 is negatively correlated with insulin secretion; subjects with longer CA repeats in HSD11B2 are more susceptible to glucose intolerance. PMID: 23357976
  49. Data suggest that interaction of p300/Sp1 (lysine acetyltransferase 2B/transcription factor Sp1) with HSD11B2 promoter plays crucial role in histone acetylation in syncytiotrophoblasts; these interactions may be important in placentation. PMID: 23714681
  50. cortisol/cortisone ratio increased with age, but cortisone decreased, suggesting decrease in 11beta-HSD2 activity. Results suggest that cortisol-mediated activation of mineralocorticoid receptor may explain blood pressure increase in elderly subjects. PMID: 23443726
  51. 11beta-hydroxysteroid dehydrogenase-2 is a cortisol-inactivating enzyme with a role in keratinocyte cell proliferation and basal cell proliferation PMID: 23362866
  52. The reduced activity of the 11beta-HSD2 gene seen in the preterm delivery group may impair fetal defences against maternal glucocorticoid exposure PMID: 22959142
  53. Methoxychlor and its metabolite HPTE inhibited both isoforms of 11beta-HSD in a species- and chemical structure-dependent manner. PMID: 23333641
  54. The induction of leptin and 11beta-HSD2 in the syncytiotrophoblast by CRH might promote fetal nutrient supply and placental corticosteroid metabolism in the phase before labour induction. PMID: 22971074
  55. Genetic testing of those three siblings with the typical clinical features of apparent mineralocorticoid excess syndrome has detected missense mutation HSD11B2 gene in the homozygous state. PMID: 23329753
  56. We have elucidated a functional deficiency of 11beta-hydroxysteroid dehydrogenase type 2 in children with chronic kidney disease and a subset of essential hypertension. PMID: 22872687
  57. Sequence comparison revealed the presence of an alanine at position 253 on zebrafish 11beta-HSD2, corresponding to cysteine-264 in the substratebinding pocket of the human enzyme PMID: 22796344
  58. These findings provide evidence for an association between prenatal maternal mood and downregulation of placental 11beta-HSD2 PMID: 22001010
  59. evidence for a weak or absent expression of neonatal renal 11betaHSD2 that is conserved among species PMID: 22359645
  60. These results suggest that factors in the intrauterine environment which contribute to birth outcome may be associated with placental methylation of the HSD11B2 gene. PMID: 22432047
  61. The underexpression of 11beta-HSD2 after the 33rd week in impending intrauterine fetal asphyxia in IUGR points to an increased sensitivity to hypoxia when impending asphyxia is present in the late phase of IUGR pregnancies. PMID: 22239940
  62. 11beta-HSD2 is a cause of glucocorticoid-resistance in acute lymphoblastic leukemia. PMID: 21794917
  63. there is increased NAD(+)-dependent activity of 11bHSD2 in first trimester placentae from pregnancies at higher risk of developing pre-eclampsia. PMID: 21767875
  64. Ligand-receptor interaction between triterpenoids and the 11beta-hydroxysteroid dehydrogenase type 2 (11betaHSD2) enzyme predicts their toxic effects against tumorigenic r/m HM-SFME-1 cells. PMID: 21880714
  65. Data show that perfluoroalkylated substances exhibit competitive inhibition of both human and rat 11beta-HSD2 activities, and suggest that perfluorooctane sulfonate is a potent endocrine disruptor for glucocorticoid metabolism. PMID: 21237268
  66. The role of 11beta-hydroxysteroid dehydrogenase type 2 in human hypertension. PMID: 19909806
  67. Acute exposure of a low dose of cadmium to choriocarcinoma cells decreased corisol production associated with increased 11beta-hydroxysteroid dehydrogenase 2 expression. PMID: 20624455
  68. Structure-function analysis of pathological variation in the HSD11B2 gene sequence. PMID: 20571110
  69. Defects of the 11betaHSD2 gene do not constitute a likely cause for licorice-induced hypertension. PMID: 20597806
  70. Repeated administration of dexamethasone can upregulate the expression level of 11beta-HSD2 in primary cultured cytotrophoblasts from preterm placenta. PMID: 19292059
  71. hCG is an important paracrine or autocrine hormone maintaining 11beta-HSD2 expression in syncytiotrophoblasts. Up-regulation of 11beta-HSD2 expression by cortisol may be mediated in part by hCG. PMID: 19880179
  72. effect of ATP on activity in human placental microsomes PMID: 11787058
  73. in vivo footprinting of promoter and cell-specific regulation by Sp1 and Sp3 PMID: 11850421
  74. Weak associations between the HSD11B2 gene, type 1 diabetes mellitus and nephropathy. PMID: 11916625
  75. chenodeoxycholic acid and deoxycholic acid, by inhibiting 11 beta HSD2, mediate cortisol-dependent nuclear translocation and transcriptional activation of Mineralocorticoid receptor PMID: 12015312
  76. The expression of 11 beta-hydroxysteroid dehydrogenase type 2 is induced during trophoblast differentiation: effects of hypoxia. PMID: 12161498
  77. first report to suggest that 11 beta-hydroxysteroid dehydrogenase 2 is O(2) dependent in first and third trimester placenta during human gestation PMID: 12364476
  78. In small preterm infants, reduced placental 11 beta-HSD2 function is asociated with low relative birth weight and severe fetal distress. PMID: 12519895
  79. Nonfunctioning adenomas and those causing preclinical and overt Cushing's syndrome may represent a continuum with clinical manifestations depending mainly on tumor size and HSD11B2 expression levels. PMID: 12574226
  80. determination of abnormal expression in pituitary adenomas PMID: 12642869
  81. 11 beta-Hydroxysteroid dehydrogenase type 2 (11 beta-HSD2) plays a crucial role in converting hormonally active cortisol to inactive cortisone, thereby conferring specificity on the mineralocorticoid receptor. Review. PMID: 12788832
  82. Homozygous mutation in exon 4 Asp223Asn changed the enzyme's surface electrostatic potential affecting the cofactor and substrate enzyme-binding capacity. PMID: 12788846
  83. Late-onset apparent mineralocorticoid excess caused by novel compound heterozygous mutations in the HSD11B2 gene. PMID: 12860834
  84. Ang II decreases activity of 11beta-HSD2 by AT2 receptor- and MAPK-dependent mechanism. Decreased activity of 11beta-HSD2 increases intracellular availability of cortisol. May be relevant for pathogenesis of hypertension and preeclampsia. PMID: 12911547
  85. An increase in the expression of 11 beta-HSD2 may result in faster glucocorticoid breakdown in lung cells in patients with acute respiratory distress syndrome (ARDS). PMID: 14629298
  86. results suggest that renal 11-hydroxysteroid dehydrogenase 2 is a main factor controlling the equilibrium of plasma cortisol and cortisone concentrations in the periphery PMID: 14681848
  87. Patients with essential hypertension and without any biological evidence of aldosterone excess have an overall significant 39% reduction in ex vivo HSD2 catalytic activity in sweat gland ducts, as compared with normotensive subjects. PMID: 14981055
  88. Decrease of 11betaHSD2 mRNA abundance and enzyme activity is associated with colorectal cancer PMID: 15172126
  89. The antiproliferative effects of glucocorticosteroids were reversed and total cell growth boosted by overexpression of 11beta-HSD2. The increase in cell proliferation was attained by low 11beta-HSD2 overexpression. PMID: 15305225
  90. These results indicate a role for DNA methylation in 11 beta-hydroxysteroid dehydrogenase type 2 gene repression and suggest an epigenetic mechanism affecting this gene causally linked with hypertension. PMID: 15489962
  91. 11beta-HSD2 is an additional target for PPAR delta, which may regulate human placental function PMID: 15591138
  92. Critical role of 11betaHSD2 for ensuring selectivity of the mineralocarticoid receptors in the distal nephron PMID: 15643119
  93. hypertensives with suppressed renin activity may have an impairment in the cortisol inactivation catalyzed by the enzyme 11betaHSD2, which could be associated with the length of CA-repeat microsatellite in intron 1 of the HSD11B2 gene PMID: 15643127
  94. Reduced renal 11beta-HSD2 expression may lead to occupancy of the MR by glucocorticoids such as cortisol and may contribute to the increased sodium retention seen in patients with impaired renal function PMID: 16061836
  95. Study identifies placental 11 beta-HSD2 as a novel molecular target of cadmium. PMID: 16144812
  96. The reduced placental 11beta-HSD2 in fetal growth restriction is not due to intrinsic abnormalities in trophoblast cells, but likely a result of extrinsic factors associated with FGR. PMID: 16271275
  97. lung inflammation reduces local glucocorticoid breakdown and augments glucocorticoid action in the lung by down-regulating 11beta-HSD2 via multiple mechanisms PMID: 16272800
  98. 11BetaHSD-2 and GR were expressed across the mensrual cycle. PMID: 16406280
  99. missense mutations in HSD11B2 do not substantially contribute to essential hypertension in Japanese PMID: 16778331
  100. The 3 most significantly overexpressed genes were in rheumatoid arthritis were laeverin, 11beta-hydroxysteroid dehydrogenase type 2 (a steroid pathway enzyme), and cysteine-rich, angiogenic inducer 61 (a known angiogenic factor). PMID: 16804865

Show More

Hide All

Involvement in disease Apparent mineralocorticoid excess (AME)
Subcellular Location Microsome, Endoplasmic reticulum
Protein Families Short-chain dehydrogenases/reductases (SDR) family
Tissue Specificity Expressed in kidney, pancreas, prostate, ovary, small intestine and colon. At midgestation, expressed at high levels in placenta and in fetal kidney and, at much lower levels, in fetal lung and testis (PubMed:8530071).
Database Links

HGNC: 5209

OMIM: 218030

KEGG: hsa:3291

STRING: 9606.ENSP00000316786

UniGene: Hs.1376

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved. 鄂ICP备15011166号-1