Recombinant Human Corticotropin-releasing factor receptor 1 (CRHR1), partial

In Stock
Code CSB-EP005965HU
Abbreviation Recombinant Human CRHR1 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Neuroscience
Alternative Names
Corticotropin releasing factor type 1 receptor; corticotropin releasing hormone receptor 1; Corticotropin-releasing factor receptor 1; Corticotropin-releasing hormone receptor 1; CRF R; crf receptor 1; crf receptor type 1; crf type 1; CRF-R; CRF-R-1; CRF-R1; CRF1; CRFR; CRFR-1; CRFR1; CRFR1_HUMAN; CRH-R-1; CRH-R1; CRH-R1h; CRHR; Crhr1; CRHR1f; CRHR1L
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
24-121aa
Target Protein Sequence
SLQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAVI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
37.9kDa
Protein Length
Partial
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Corticotropin-releasing factor receptor 1 (CRHR1) is produced through an E. coli expression system and represents a partial protein segment spanning amino acids 24 to 121. The protein carries an N-terminal GST tag to help with purification and detection. SDS-PAGE analysis confirms the product maintains a purity level above 90%, which appears to provide good reliability for research work. This product is meant strictly for research use and cannot be used for therapeutic purposes.

CRHR1 seems to be a key player in the corticotropin-releasing hormone signaling pathway. The receptor likely plays an important role in how we handle stress by controlling the hypothalamic-pituitary-adrenal (HPA) axis. This makes CRHR1 particularly interesting for scientists studying stress responses, brain function, and hormone systems - offering a useful target for research into the molecular details of these complex processes.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

GPCRs require precise seven-transmembrane domain folding within a lipid membrane environment, along with specific post-translational modifications like glycosylation. This partial fragment, representing only a portion of the extracellular domain (24-121aa), lacks the full structural context and cannot form the complete ligand-binding pocket. The bacterial expression system cannot provide the necessary membrane environment or eukaryotic folding machinery. Therefore, this recombinant protein is highly unlikely to achieve a native-like conformation or possess functional ligand-binding activity.

1. Antibody Development and Validation

This recombinant CRHR1 fragment serves as an excellent immunogen for generating antibodies specific to this extracellular region of human CRHR1. The high purity and defined sequence ensure specific antibody production. However, antibodies generated against this bacterially expressed fragment may primarily recognize linear epitopes and might not efficiently bind to the properly folded, glycosylated form of the receptor on the cell surface in native tissues.

2. ELISA-Based Screening and Detection Assays

This protein is well-suited as a standard for immunoassay development to measure antibody binding or as a coating antigen. However, it is completely unsuitable for functional screening of receptor-ligand interactions. It can be used in ELISA formats to screen for antibodies or to compete for antibody binding, but not to study CRF binding to the receptor.

Final Recommendation & Action Plan

This recombinant CRHR1 protein is limited to non-structural, immunological uses. The protein can be reliably used for Application 1 (Antibody Development) and Application 2 (as an immunoassay standard). Interaction studies and binding studies are not recommended as they require the native, full-length receptor structure in a membrane environment. For functional studies of CRHR1, the only valid path is to use a full-length receptor expressed in mammalian cells or native tissue preparations.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
G-protein coupled receptor for CRH (corticotropin-releasing factor) and UCN (urocortin). Has high affinity for CRH and UCN. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and down-stream effectors, such as adenylate cyclase. Promotes the activation of adenylate cyclase, leading to increased intracellular cAMP levels. Inhibits the activity of the calcium channel CACNA1H. Required for normal embryonic development of the adrenal gland and for normal hormonal responses to stress. Plays a role in the response to anxiogenic stimuli.
Subcellular Location
Cell membrane; Multi-pass membrane protein. Endosome. Note=Agonist-binding promotes endocytosis.
Protein Families
G-protein coupled receptor 2 family
Tissue Specificity
Predominantly expressed in the cerebellum, pituitary, cerebral cortex and olfactory lobe.
Database Links

HGNC: 2357

OMIM: 122561

KEGG: hsa:104909134

STRING: 9606.ENSP00000381333

UniGene: Hs.417628

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*