Recombinant Human Cyclin-dependent kinase 4 inhibitor D(CDKN2D)

Code CSB-EP005095HU
Product Type Recombinant Protein
Size US$2466
Uniprot No. P55273
Relevance Interacts strongly with CDK4 and CDK6 and inhibits them
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias p19-INK4d
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGASPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL
Research Area Cell Biology
Source E.coli
Gene Names CDKN2D
Protein Names Recommended name: Cyclin-dependent kinase 4 inhibitor D Alternative name(s): p19-INK4d
Expression Region 1-166aa
Tag Info N-terminal GST-tagged
Mol. Weight 44.7kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Interacts strongly with CDK4 and CDK6 and inhibits them.
Subcellular Location Nucleus, Cytoplasm
Protein Families CDKN2 cyclin-dependent kinase inhibitor family
Database Links

HGNC: 1790

OMIM: 600927

KEGG: hsa:1032

STRING: 9606.ENSP00000337056

UniGene: Hs.435051

Pathway Cell cycle
FoxO signaling pathway

Related Products

CDKN2D Antibodies

CDKN2D Antibodies for Homo sapiens (Human)

CDKN2D Antibodies for Human

CDKN2D Proteins

CDKN2D Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.