Recombinant Human Cyclin-dependent kinases regulatory subunit 2 (CKS2)

In Stock
Code CSB-EP005468HU
Abbreviation Recombinant Human CKS2 protein
MSDS
Size US$256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
CKS2
Uniprot No.
Research Area
Cell Biology
Alternative Names
CDC28; CDC28 protein kinase 2; CDC28 protein kinase regulatory subunit 2; CKS 2; CKS-2; CKS1(S. cerevisiae Cdc28/Cdc2 kinase subunit) homolog 2; Cks2; CKS2_HUMAN; CKSHS2; Cyclin dependent kinases regulatory subunit 2; Cyclin-dependent kinases regulatory subunit 2
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-79aa
Target Protein Sequence
MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
17.3 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Cyclin-dependent kinases regulatory subunit 2 (CKS2) is expressed in E. coli, covering the full-length protein from amino acids 1 to 79. The protein carries an N-terminal 10xHis-tag and a C-terminal Myc-tag, which should help with purification and detection. SDS-PAGE analysis confirms the product shows purity greater than 90%, making it appropriate for various research applications.

CKS2 appears to be an integral component of the cell cycle. It plays what seems to be a crucial role in regulating cyclin-dependent kinases. Research suggests it's involved in cell cycle progression, and scientists have studied its interactions with other cell cycle proteins to better understand cell division mechanisms. This likely makes CKS2 a valuable protein for research in cellular regulation and cancer studies.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Protein-Protein Interaction Studies Using Pull-Down

AssaysHuman CKS2 is a small, soluble protein that functions as a regulatory subunit for cyclin-dependent kinases. Its activity depends on correct folding to form the conserved "kip/cip" structure that mediates protein-protein interactions. The E. coli expression system can often successfully fold small, soluble eukaryotic proteins like CKS2. If correctly folded, the protein could identify physiological binding partners like CDK1 or CDK2. However, the dual N-terminal and C-terminal tags may potentially interfere with the protein's native structure and interaction interfaces, leading to false-negative results or non-specific (false-positive) binding. Interaction studies should be considered exploratory until validated with complementary approaches. While there's a reasonable probability of correct folding, the functional activity (particularly its ability to bind CDKs) cannot be guaranteed without experimental validation.

2. Antibody Development and Validation

This recombinant CKS2 serves as an excellent immunogen for generating specific antibodies. The full-length sequence ensures comprehensive epitope coverage, and the high purity minimizes antibodies against contaminants. While the tags may affect some conformational epitopes, they provide excellent handles for purification and screening during antibody development.

3. Biochemical Characterization and Stability Studies

This is the essential first step to assess protein quality and folding. Techniques like size-exclusion chromatography with multi-angle light scattering (SEC-MALS) can determine oligomeric state and homogeneity, while circular dichroism can analyze secondary structure content. These biophysical analyses directly address the folding uncertainty and provide the foundation for evaluating the protein's suitability for functional studies.

4. In Vitro Binding Assays and Competition Studies

This application is highly dependent on correct folding and tag positioning. If the protein is properly structured and the tags don't block binding interfaces, it could be used for quantitative binding studies with known partners like cyclin-CDK complexes. However, if misfolded or sterically hindered, binding data will be unreliable. Competition studies should only be attempted after confirming proper folding through Application 3 and validating basic binding activity with a positive control interaction.

Final Recommendation & Action Plan

The small size of CKS2 makes correct folding in E. coli plausible, but the dual-tag configuration introduces uncertainty about functional integrity. The immediate priority should be Application 3 (Biochemical Characterization) to validate proper folding and monodispersity through SEC-MALS and circular dichroism. If the protein shows correct structural properties, proceed to validate its binding capability with a known partner before attempting Applications 1 and 4. Application 2 (Antibody Development) can proceed immediately regardless of folding status. For critical functional studies, consider testing tag removal or using tag-free alternatives if initial binding validation fails. This systematic approach ensures reliable interpretation of experimental results.

Customer Reviews and Q&A

 Customer Reviews
Average Rating:
5.0 - 1 reviews

Submit a Review here

Applications : /

Review: CKS2 was individually diluted in 50 mm sodium carbonate/bicarbonate buffer (pH 9.6) to the corresponding concentration.

By Anonymous

Target Background

Function
Binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function.
Gene References into Functions
  1. that CKS2 play a role in tumor activation and serve as a useful potential target for the treatment of hepatocellular carcinoma PMID: 29487004
  2. CKS2 is up-regulated in breast cancer and associated with large tumor size, lack expression of progesterone receptor, poor tumor differentiation and survival PMID: 25674223
  3. CKS2 mRNA expression was higher in cancer tissue than in corresponding normal tissue. Patients with positive-CKS2 protein expression had a poorer five year survival frequency than patients who did not express CKS2 protein. PMID: 24604089
  4. CKS2 mRNA and protein expression were increased in esophageal carcinoma. Overexpression of CKS2 was associated with higher grad, regional lymph node invasion, and neoplastic embolus. CKS2 was negatively associated with the p27(kip1) level in the tumor. PMID: 23301842
  5. miR-26a and its target CKS2 modulate cell growth and tumorigenesis of papillary thyroid carcinoma. PMID: 23861775
  6. Cks2 may serve as an independent prognostic factor in patients with cholangiocarcinoma, and play a role in the carcinogenesis of cholangiocarcinoma by facilitating cell cycle progression and Bax-mediated mitochondrial caspase-dependent apoptosis. PMID: 23121546
  7. Study calculated DeltaCt values of CKS2 and LEPR and found that their differential expression (C-L index) was significantly higher in grade I than in grade II or III meningiomas. PMID: 21948653
  8. The Cks2 gene may have potential as a biomarker for predicting superficial bladder cancer progression to muscle-invasive cancer. PMID: 21672358
  9. CKS2 is one of the gastric cancer-related genes that correlates with biological aggressiveness and poor prognosis of gastric cancer. PMID: 21617860
  10. the involvement CKS2 gene expression in bladder cancer tumorgenesis PMID: 20920335
  11. p53, rather than its homologues p63 and p73, may contribute to control of the first metaphase/anaphase transition of mammalian meiosis by downregulation of Cks2 expression PMID: 17336302
  12. Elevated expression of Cks1 may contribute to prostate tumorigenesis by promoting proliferation, anchorage-independent growth and migration of the cells, and elevated expression of Cks2 by protecting cells from undergoing programmed cell death. PMID: 18498131
  13. Data show that cyclin-dependent kinase-associated proteins Cks1 and Cks2 are essential during early embryogenesis and for cell cycle progression in somatic cells. PMID: 18625720
  14. Results suggest that the cell cycle regulator CKS2 might be deeply involved in gastric cancer progression. PMID: 19034516

Show More

Hide All

Protein Families
CKS family
Database Links

HGNC: 2000

OMIM: 116901

KEGG: hsa:1164

STRING: 9606.ENSP00000364976

UniGene: Hs.83758

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*