Recombinant Human Cytochrome P450 11B1, mitochondrial(CYP11B1)

Code CSB-EP006390HU
Product Type Recombinant Protein
Size US$2466
Uniprot No. P15538
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP006390HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CYP11B1.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP006390HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CYP11B1.
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence GTRAARVPRTVLPFEAMPRRPGNRWLRLLQIWREQGYEDLHLEVHQTFQELGPIFRYDLGGAGMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQQYTSIVAELLLNAELSPDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRPERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQEDIKMVYSFILRPSMFPLLTFRAIN
Research Area Cancer
Source E.coli
Gene Names CYP11B1
Protein Names Recommended name: Cytochrome P450 11B1, mitochondrialAlternative name(s): CYPXIB1 Cytochrome P-450c11 Short name= Cytochrome P450C11 Steroid 11-beta-hydroxylase EC= 1.14.15.4
Expression Region 25-503aa
Tag Info N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Mol. Weight 74.9 kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Has steroid 11-beta-hydroxylase activity. In addition to this activity, the 18 or 19-hydroxylation of steroids and the aromatization of androstendione to estrone have also been ascribed to cytochrome P450 XIB.
Involvement in disease Adrenal hyperplasia 4 (AH4); Hyperaldosteronism, familial, 1 (HALD1)
Subcellular Location Mitochondrion membrane
Protein Families Cytochrome P450 family
Database Links

HGNC: 2591

OMIM: 103900

KEGG: hsa:1584

STRING: 9606.ENSP00000292427

UniGene: Hs.184927

Q&A and Customer Reviews

Q&A
Q:

Please provide the following information regarding CSB-EP006390HU.
1.Sequence
2.Tag type
3.Tag position
4.Pricing, sizes and formats
Do you know if this product exhibits a P450 binding difference spectrum?

A:
Thanks for your inquiry.
Recombinant Human Cytochrome P450 11B1, mitochondrial(CYP11B1)
CSB-EP006390HU >> E.coli
You can view the full information of sequence and Tag on this page.
Sorry, as to whether this product exhibits a P450 binding difference spectrum, we haven't done any related research, we don't know about this.
Customer Reviews

Related Products

CYP11B1 Antibodies

CYP11B1 Antibodies for Homo sapiens (Human)

CYP11B1 Antibodies for Human

CYP11B1 Proteins

CYP11B1 Proteins for Homo sapiens (Human)

CYP11B1 ELISA Kit

CYP11B1 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.