Recombinant Human Cytochrome P450 2C19 (CYP2C19)

In Stock
Code CSB-EP006417HU
Abbreviation Recombinant Human CYP2C19 protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
CYP2C19
Uniprot No.
Research Area
Others
Alternative Names
(R)-limonene 6-monooxygenase; (S)-limonene 6-monooxygenase; (S)-limonene 7-monooxygenase; CP2CJ_HUMAN; CPCJ; CYP2C; CYP2C19; CYPIIC17; CYPIIC19; Cytochrome P-450 II C; Cytochrome P450 2C19; Cytochrome P450; subfamily IIC (mephenytoin 4-hydroxylase); polypeptide 19; Cytochrome P450-11A; Cytochrome P450-254C; Flavoprotein-linked monooxygenase; Mephenytoin 4 hydroxylase; Mephenytoin 4-hydroxylase; Microsomal monooxygenase; P450-11A; P45011A; P450C2C; S-mephenytoin 4-hydroxylase; Xenobiotic monooxygenase
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
26-490aa
Target Protein Sequence
RGKLPPGPTPLPVIGNILQIDIKDVSKSLTNLSKIYGPVFTLYFGLERMVVLHGYEVVKEALIDLGEEFSGRGHFPLAERANRGFGIVFSNGKRWKEIRRFSLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTKASPCDPTFILGCAPCNVICSIIFQKRFDYKDQQFLNLMEKLNENIRIVSTPWIQICNNFPTIIDYFPGTHNKLLKNLAFMESDILEKVKEHQESMDINNPRDFIDCFLIKMEKEKQNQQSEFTIENLVITAADLLGAGTETTSTTLRYALLLLLKHPEVTAKVQEEIERVVGRNRSPCMQDRGHMPYTDAVVHEVQRYIDLIPTSLPHAVTCDVKFRNYLIPKGTTILTSLTSVLHDNKEFPNPEMFDPRHFLDEGGNFKKSNYFMPFSAGKRICVGEGLARMELFLFLTFILQNFNLKSLIDPKDLDTTPVVNGFASVPPFYQLCFIPV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
60.6 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The Human CYP2C19 protein's gene (26-490aa) is inserted into a plasmid vector, forming recombinant plasmid, which is introduced into e.coli cells. e.coli cells surviving in the presence of a specific antibiotic are selected and then cultured under conditions promoting the expression of the gene of interest. The protein features a N-terminal 10xHis tag and C-terminal Myc tag fusion. After expression, the recombinant Human CYP2C19 protein is isolated and purified from the cell lysate through affinity purification. Denaturing SDS-PAGE is utilized to resolve the resulting recombinant protein, revealing a purity exceeding 85%.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
A cytochrome P450 monooxygenase involved in the metabolism of polyunsaturated fatty acids (PUFA). Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (NADPH--hemoprotein reductase). Catalyzes the hydroxylation of carbon-hydrogen bonds. Hydroxylates PUFA specifically at the omega-1 position. Catalyzes the epoxidation of double bonds of PUFA. Also metabolizes plant monoterpenes such as limonene. Oxygenates (R)- and (S)-limonene to produce carveol and perillyl alcohol. Responsible for the metabolism of a number of therapeutic agents such as the anticonvulsant drug S-mephenytoin, omeprazole, proguanil, certain barbiturates, diazepam, propranolol, citalopram and imipramine. Hydroxylates fenbendazole at the 4' position.
Gene References into Functions
  1. The frequency distribution of alleles CYP2C19 in Yakuts is between that in the representatives of Mongoloid and Caucasian races, which can be explained by the history of forming the population of this particular region. PMID: 29738309
  2. The CYP2C19 phenotype is not predicted by the number of functional alleles of CYP2C19 and CYP3A4 genes. PMID: 29733119
  3. CYP2C19*2 genotype-guided antiplatelet treatment remained a cost-effective strategy. PMID: 28117433
  4. CYP2C19 SNP was significantly associated with high on-treatment platelet reactivity and clinical outcomes after percutaneous coronary intervention. PMID: 29352151
  5. Polymorphisms of the CYP2C19 is associated with Adverse Drug Reactions of Voriconazole among Hematological Patients after Allo-Hematopoietic Stem Cell Transplantation. PMID: 28685218
  6. In a subject with predicted CYP2C19 PM phenotype, the PK of BMS-823778 was affected significantly by UGT1A4 polymorphism. PMID: 29311135
  7. Wild-type CYP2C19*1B and 30 isoforms were highly expressed in insect cells, and the enzymatic activities of CYP2C19 variants towards nebivolol hydroxylation were characterized. Three variants, CYP2C19*29 (K28I), L16F, and CYP2C19*23 (G91R), showed increased intrinsic clearance of >140% CYP2C19*1B. PMID: 29098786
  8. Carriage of a combination of mutant alleles in multiple genes including ITGB3+CYP2C19*2 or CYP2C19*2 + ITGA2 or CYP2C19*2 are possible predictors of CVE in patients after CABG PMID: 29461866
  9. Gene polymorphism testing results indicated that patients with CYP2C19*3 had a significantly higher incidence of high on-treatment platelet reactivity. PMID: 29397568
  10. CYP2C19 genotype only partially determines the CYP2C19 phenotypic appearance. PMID: 29665549
  11. appears that 5azaDC treatment affects an unidentified upstream regulator of both CYP2C19 and/or NR1I3. This is supported by the fact that the relationships between TF for CYP2C19 and the expression of this target gene in human liver samples only accounted for approximately 70% of the variability of CYP2C19 mRNA levels. PMID: 28840784
  12. For percutaneous coronary intervention in postoperative patients, research data is still lacking regarding clopidogrel dosage on the basis of different CYP2C19 genotypes. PMID: 28164572
  13. Even heterozygous CYP2C19*2 allele carriers among Caucasian patients after ischemic stroke had a higher risk of major adverse clinical events. PMID: 29509167
  14. results obtained from this study have proven the CYP variants to be immunoreactive and spectrally active and are suitable for use to examine biotransformation and interaction mechanism of the enzymes PMID: 29524040
  15. Report association of CYP2C19 genotype with bleeding in Serbian STEMI patients who have undergone primary PCI and treatment with clopidogrel. PMID: 29260275
  16. Personalized treatment with clopidogrel or ticagrelor based on CYP2C19 genotype status ultimately led to improved clinical outcomes in acute coronary syndrome patients treated with percutaneous coronary intervention. PMID: 29243114
  17. CYP2C19*2 Polymorphism is associated with drug resistance in Breast Cancer. PMID: 29479969
  18. Comparisons of pharmacokinetics of 25 substrates CYP2C9, CYP2C19, or CYP2D6 in healthy Chinese and European subjects (classified with same enzyme activity) suggest that, for most substrates, limited interethnic pharmacokinetic differences exist (according to the databases used in this study). (CYP2C9 = cytochrome P450 family 2 subfamily C member 9; CYP2D6 = cytochrome P450 family 2 subfamily D member 6) PMID: 29181698
  19. We documented a different effect of CYP2C19 and P2Y12 receptor polymorphisms on platelet reactivity and cardiovascular outcome in coronary artery disease patients after percutaneous coronary intervention on clopidogrel treatment. Importantly, increased platelet reactivity adversely affects the cardiovascular outcome independently of the studied polymorphisms. PMID: 28329746
  20. CYP2C19*2 and elevated BMI are associated with clopidogrel HTPR. However, CYP2C19*2 genotyping doesn't predict clopidogrel response sufficiently. PMID: 28802144
  21. Results suggest a role of cytochrome P450 2C19 (CYP2C19) gene variants as a potential marker of Clopidogrel response. PMID: 29347970
  22. There is an association between cyp2c19 and loss of function allele status of clopidrogrel for stroke risk reduction PMID: 29979852
  23. The identified allele frequencies were CYP2C19*1 (64.33%), *2 (31.06%) and *3 (4.61%). The major prevalent genotype combinations were CYP2C19 *1/*1 (41.73%) and *1/*2 (39.65%). In the Hakka population, frequencies of the CYP2C19 *2 and *3 variants were observed to be close to those previously identified in Chinese and several other Asian populations. PMID: 29288619
  24. CYP2C19 polymorphisms significantly impacted systemic exposure and metabolism pathways of BMS-823778 in humans. PMID: 28850715
  25. Human but not rat liver proteins immunoblotting allowed us to characterize the novel LM antibodies and to identify CYP-2C19 as human antigen PMID: 29279846
  26. The frequency of primary outcome was significantly higher in patients carrying CYP2C19*2 AG/AA genotype receiving PPIs compared with the same genotype in those not receiving PPIs. The PPIs used in patients carrying CYP2C19*2 AG/AA was independently associated with the primary outcome after adjusting for other risk factors. PMID: 27637911
  27. PPI therapy in children with *17 alleles may be better optimized with CYP2C19 genotype-guided dosing prior to pH probe testing. PMID: 28884817
  28. Patients with CYP2C19*2 were at increased risk and CYP2C19*2, CYP3A5*3 and GSTP1 have synergistic influence on CYC failure. PMID: 28976264
  29. Consensus has yet to be reached on which CYP2D6 and CYP2C19 star alleles to include on pharmacogenetic testing panels and pharmacogenetic results reporting could be considerably improved PMID: 28777243
  30. The impact of CYP2C19 genetic polymorphisms on the efficacy of proton pump inhibitor-based triple eradication therapy in Slavic patients appears significant. PMID: 29889439
  31. A total of 42.0% carried >/=1 CYP2C19*2 allele. PMID: 28745576
  32. Implementing a CYP2C19 genotype-guided approach to antiplatelet therapy. PMID: 28745582
  33. Among children with medically refractory GERD despite proton pump inhibitor therapy, carriage of CYP2C19*17 allele corresponding to the extensive metabolizer phenotype was associated with need for anti-reflux surgery. PMID: 29209919
  34. Patients with an acute coronary event and a very poor, poor and normal CYP2C19 metabolizer genotype have a higher prevalence of diabetes mellitus needing insulin than patients with the rapid and ultrarapid metabolizers CPY2C19 genotype. PMID: 28473221
  35. In addition to the CYP2C19 genotype as predictive factors. PMID: 28834922
  36. no association was identified between the CYP2C19()2 variant and the development of coronary in-stent restenosis. PMID: 28785581
  37. CYP2C19 genetic polymorphisms had significant influence on the antiplatelet effect of clopidogrel and clinical outcomes in patients with intracranial aneurysms treated with stent-assisted coiling. PMID: 27634953
  38. The ultrarapid-metabolizing *17 allele of CYP2C19 (OMIM 124020), which is common in Europeans and Africans and rare in Asians, results in higher circulating concentrations of VNO. We hypothesized that LTRs with the *17 allele would have an increased risk for voriconazole-associated SCC. PMID: 26982740
  39. This gastric juice-based real-time PCR assay is a more accurate method for detecting H. pylori infection, clarithromycin susceptibility and CYP2C19 polymorphisms. The method may be employed to inform the choice of proton pump inhibitor (PPI), clarithromycin and amoxicillin treatment for tailored H. pylori eradication therapy PMID: 28638276
  40. This study showed that distinct genetic markers were associated with phenotype-specific PHT-induced severe cutaneous adverse drug reactions. HLA-B*13:01, HLA-B*56:02/04, and CYP2C19*3 were potential genetic markers of phenytoin-induced drug rash with eosinophilia and systemic symptoms/drug hypersensitivity syndrome in Thai patients. PMID: 28391407
  41. The present study aimed to assess the effects of CYP2C19 gene polymorphisms on proton pump inhibitor (PPI), amoxicillin, and levofloxacin triple therapy for Helicobacter pylori (Hp) eradication. PMID: 28577017
  42. efficacy of clopidogrel for the prevention of ischemic stroke in post-coronary stent patients may be reduced by the insufficiency of the CYP2C19 gene PMID: 29188612
  43. These data highlight the potential relevance of CYP2C19 pharmacogenetics in influencing NorEND concentrations in tamoxifen-treated patients, which may influence treatment outcomes PMID: 26799162
  44. We compared the carrier frequency of Cytochrome P450 Enzymes and Transport Proteins markers among the Russian population living in Moscow with Dagestan ethnic groups. Statistically significant differences for the following gene polymorphisms: CYP2C19*17, CYP2C9*3, ABCB1 (C3435T), SLCO1B1*5 were found between the Russian population and the three ethnic groups of the Dagestan republic. PMID: 29023140
  45. SNP rs4244285 of CYP2C19 tended to be associated with decreased risk of essential hypertension. PMID: 28513222
  46. CYP2C19 polymorphism analysis may improve treatment decisions in patients with ACS receiving DES-PCI PMID: 29279531
  47. Our results suggest that CYP2C19 LOF alleles (*2 and *3) significantly impact the prognosis of patients on clopidogrel therapy after CAS and that the CYP2C19*2 and CYP2C19*3 alleles have the same effects on prognosis PMID: 27137706
  48. Behcet's disease patients had lower CYP2C19 enzyme activity and lower frequency of the CYP2C19*17 allele as compared to those of the healthy controls. PMID: 27875029
  49. CYP2C19 polymorphism does not affect rosuvastatin pharmacokinetics in healthy Taiwanese in a clinically meaningful way. PMID: 27128002
  50. On-treatment platelet reactivity was compared between patients stratified by diabetes mellitus (DM), CYP2C19*2 status and clopidogrel dose. Both DM and CYP2C19*2 were independently associated with elevated on-treatment platelet reactivity with clopidogrel 75 mg daily. PMID: 27009617

Show More

Hide All

Subcellular Location
Endoplasmic reticulum membrane; Peripheral membrane protein. Microsome membrane; Peripheral membrane protein.
Protein Families
Cytochrome P450 family
Database Links

HGNC: 2621

OMIM: 124020

KEGG: hsa:1557

STRING: 9606.ENSP00000360372

UniGene: Hs.282409

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*