Purity
Greater than 85% as determined by SDS-PAGE.
Alternative Names
(R)-limonene 6-monooxygenase; (S)-limonene 6-monooxygenase; (S)-limonene 7-monooxygenase; CP2CJ_HUMAN; CPCJ; CYP2C; CYP2C19; CYPIIC17; CYPIIC19; Cytochrome P-450 II C; Cytochrome P450 2C19; Cytochrome P450; subfamily IIC (mephenytoin 4-hydroxylase); polypeptide 19; Cytochrome P450-11A; Cytochrome P450-254C; Flavoprotein-linked monooxygenase; Mephenytoin 4 hydroxylase; Mephenytoin 4-hydroxylase; Microsomal monooxygenase; P450-11A; P45011A; P450C2C; S-mephenytoin 4-hydroxylase; Xenobiotic monooxygenase
Species
Homo sapiens (Human)
Expression Region
26-490aa
Target Protein Sequence
RGKLPPGPTPLPVIGNILQIDIKDVSKSLTNLSKIYGPVFTLYFGLERMVVLHGYEVVKEALIDLGEEFSGRGHFPLAERANRGFGIVFSNGKRWKEIRRFSLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTKASPCDPTFILGCAPCNVICSIIFQKRFDYKDQQFLNLMEKLNENIRIVSTPWIQICNNFPTIIDYFPGTHNKLLKNLAFMESDILEKVKEHQESMDINNPRDFIDCFLIKMEKEKQNQQSEFTIENLVITAADLLGAGTETTSTTLRYALLLLLKHPEVTAKVQEEIERVVGRNRSPCMQDRGHMPYTDAVVHEVQRYIDLIPTSLPHAVTCDVKFRNYLIPKGTTILTSLTSVLHDNKEFPNPEMFDPRHFLDEGGNFKKSNYFMPFSAGKRICVGEGLARMELFLFLTFILQNFNLKSLIDPKDLDTTPVVNGFASVPPFYQLCFIPV
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The Human CYP2C19 protein's gene (26-490aa) is inserted into a plasmid vector, forming recombinant plasmid, which is introduced into e.coli cells. e.coli cells surviving in the presence of a specific antibiotic are selected and then cultured under conditions promoting the expression of the gene of interest. The protein features a N-terminal 10xHis tag and C-terminal Myc tag fusion. After expression, the recombinant Human CYP2C19 protein is isolated and purified from the cell lysate through affinity purification. Denaturing SDS-PAGE is utilized to resolve the resulting recombinant protein, revealing a purity exceeding 85%.