Recombinant Human E3 ubiquitin-protein ligase RAD18 (RAD18)

Code CSB-EP889102HU
Abbreviation Recombinant Human RAD18 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
2810024C04Rik; DNA repair protein rad18; E3 ubiquitin-protein ligase RAD18; EC 6.3.2.-; hHR 18; hHR18; hRAD 18; hRAD18; MGC156682; Postreplication repair E3 ubiquitin-protein ligase RAD18; Postreplication repair protein hRAD18p; Postreplication repair protein RAD18; RAD 18; RAD18; RAD18 homolog (S. cerevisiae); RAD18 homolog; RAD18 S. cerevisiae homolog; RAD18 S. cerevisiae homolog of; RAD18 transcript variant; RAD18_HUMAN; Rad18sc; Radiation sensitivity protein 18; RING finger protein 73; RNF 73; RNF73; Structural maintenance of chromosomes protein 6; YCR066W; YCR66W
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-495aa
Target Protein Sequence
MDSLAESRWPPGLAVMKTIDDLLRCGICFEYFNIAMIIPQCSHNYCSLCIRKFLSYKTQCPTCCVTVTEPDLKNNRILDELVKSLNFARNHLLQFALESPAKSPASSSSKNLAVKVYTPVASRQSLKQGSRLMDNFLIREMSGSTSELLIKENKSKFSPQKEASPAAKTKETRSVEEIAPDPSEAKRPEPPSTSTLKQVTKVDCPVCGVNIPESHINKHLDSCLSREEKKESLRSSVHKRKPLPKTVYNLLSDRDLKKKLKEHGLSIQGNKQQLIKRHQEFVHMYNAQCDALHPKSAAEIVREIENIEKTRMRLEASKLNESVMVFTKDQTEKEIDEIHSKYRKKHKSEFQLLVDQARKGYKKIAGMSQKTVTITKEDESTEKLSSVCMGQEDNMTSVTNHFSQSKLDSPEELEPDREEDSSSCIDIQEVLSSSESDSCNSSSSDIIRDLLEEEEAWEASHKNDLQDTEISPRQNRRTRAAESAEIEPRNKRNRN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
72.2kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

We want use this RAD18 recombinant protein to spike into our cell culture. Do you have any data regarding the concentration of this protein that starts to damage cells in culture?

A:

We have not conducted relevant experiments to verify whether the product CSB-EP889102HU can be used for cell culture. We recommend that you try gradient testing.
It has been reported in the literature that the concentration of Rad6–RAD18 complex used in cell experiments is 100 nM, and you can try it within this range.
Reference the literature:
https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8958325/

Target Background

Function
E3 ubiquitin-protein ligase involved in postreplication repair of UV-damaged DNA. Postreplication repair functions in gap-filling of a daughter strand on replication of damaged DNA. Associates to the E2 ubiquitin conjugating enzyme UBE2B to form the UBE2B-RAD18 ubiquitin ligase complex involved in mono-ubiquitination of DNA-associated PCNA on 'Lys-164'. Has ssDNA binding activity.
Gene References into Functions
  1. Data showed an inverse correlation between RAD18 protein expression and patient prognosis. PMID: 29306013
  2. Rad18, independently of its ubiquitin ligase activity, promotes DNA polymerase eta SUMOylation by facilitating its interaction with its SUMO ligase PIAS1 and is required for DNA polymerase eta function at difficult to replicate loci. PMID: 27811911
  3. MAGE-A4 depletion from MAGE-A4-expressing cancer cells destabilizes RAD18. PMID: 27377895
  4. Data suggest that, as part of DNA repair in nucleus of embryonic stem cells, IGF1R interacts with and phosphorylates PCNA at tyrosine residues 60, 133, and 250; this is followed by mono- and polyubiquitination of PCNA by RAD18 and SHPRH. (IGF1R = insulin-like growth factor 1 receptor; PCNA = proliferating cell nuclear antigen; RAD18 = E3 ubiquitin-protein ligase RAD18; SHPRH = E3 ubiquitin-protein ligase SHPRH) PMID: 28924044
  5. Ubiquitin ligases RNF168, RNF169, and RAD18 specifically bind histone H2A Lys13/15-ubiquitylated nucleosomes. 53BP1 chromatin recruitment may be activated by RNF168 and blocked by RNF169 and RAD18. PMID: 28506460
  6. WRNIP1 connects PCNA monoubiquitination with ATMIN/ATM to activate ATM signalling in response to replication stress and contribute to the maintenance of genomic stability. PMID: 26549024
  7. RAD18 polymorphisms are correlated with the side effects of platinum-chemotherapy in Chinese patients with advanced NSCLC. PMID: 27665847
  8. REV1 can promote PCNA monoubiquitylation after UV radiation through interacting with ubiquitylated RAD18. PMID: 26795561
  9. USP7-mediated de-ubiquitylation protects Rad18 from proteasomal degradation and is necessary for the integrity of the specialized translesion synthesis pathway PMID: 25961918
  10. RAD18 can function as a mediator for DNA damage response signals to activate the G2/M checkpoint in order to maintain genome integrity and cell survival after IR exposure. PMID: 25675240
  11. Significantly restored tolerance of RAD18-/- and RNF8-/- cells to camptothecin and olaparib without affecting Rad51 focus formation. PMID: 25417706
  12. these results suggest that miR-145 can act as an RAD18 inhibitor and contribute as an important factor in reversing drug resistance after chemotherapy. PMID: 25913620
  13. We obtained a molecular envelope for Rad18 UBZ-ELRM:linear Ub2 polyubiquitin chains by small-angle X-ray scattering and derived a structural model for the complex. PMID: 25756347
  14. Rad18 protein ubiquitin-binding zinc fingers domain has alpha-helix and strand beta1 conformation. PMID: 25162118
  15. Monoubiquitination has a role in controlling Rad18 function. PMID: 25023518
  16. The Rad6/18 ubiquitin complex interacts with the Epstein-Barr virus deubiquitinating enzyme, BPLF1, and contributes to virus infectivity. PMID: 24672041
  17. HHR6 and hRad18 can monoubiquitinate FANCD2 at lysine 561 in vitro. This activity may represent a novel stress response pathway. PMID: 24036990
  18. Findings indicate that RAD18 may serve as a key mediator of the ionizing radiation (IR)response and may function as a potential target for circumventing IR resistance in glioblastoma multiforme (GBM). PMID: 24518219
  19. Non-canonical CRL4A/4B(CDT2) interacts with RAD18 to modulate post replication repair and cell survival. PMID: 23555860
  20. Rad18 plays distinct roles in protecting the genome from oxidative DNA damage in different cell cycle stages. PMID: 23295675
  21. Rad18 is targeted to PCNA by DNA polymerase eta. PMID: 23345618
  22. RNF168, its paralog RNF169, RAD18, and the BRCA1-interacting RAP80 protein accumulate at DNA double strand break sites through the use of bipartite modules composed of ubiquitin binding sites. PMID: 22742833
  23. E2F3 controls the ubiquitination of PCNA through the transcriptional regulation of Rad18. PMID: 22391204
  24. Ser409, located within the pol-eta binding domain of Rad18, is phosphorylated by c-jun kinase in response to dna damage, promoting the interaction between Rad18 and pol-eta. PMID: 22456510
  25. Rad18 is involved in the regulation of melanoma cell proliferation. PMID: 22145991
  26. The Rad6-Rad18 enzyme plays an essential role in promoting replication through DNA lesions by translesion synthesis in mammalian cells. PMID: 22547805
  27. Hydroquinone could upregulate the expression of Rad18 in L-02 hepatic cells. PMID: 19493487
  28. RAD18 interacts with BRCTx in a phosphorylation-dependent manner PMID: 22036607
  29. The results demonstrate that RAD6A and RAD18 form a ternary complex, RAD6A-(RAD18)(2) and the presence of only one RAD6-binding domain in the two RAD18 subunits is sufficient for ternary complex formation and the ligase activity. PMID: 21967848
  30. Data indicate that association of RAD18 with DSBs through ubiquitylated H2A and other ubiquitylated chromatin components allows recruitment of RAD9. PMID: 21858012
  31. Data show that the homodimeric Rad18 RING domain can recruit two Rad6b E2 enzymes, whereas the full-length Rad18 homodimer binds only to a single Rad6b molecule. PMID: 21549715
  32. A novel pathway of Rad18-dependent DSB repair that is dissociable from known Rad18-mediated DNA repair mechanisms based on its independence from PCNA ubiquitination and requirement for E3 ligase activity. PMID: 21478670
  33. E3 ligase Rad18 promotes monoubiquitination rather than ubiquitin chain formation by E2 enzyme Rad6. PMID: 21422291
  34. showed that the function of FA signaling pathway is at least partly mediated through coupling with hRad6/hRad18 signaling (HHR6 pathway) PMID: 20967207
  35. RAD18-mediated PCNA monoubiquitination is a central hub for the mobilization of the Fanconi anemia DNA repair network pathway. PMID: 20937699
  36. Rad18 promotes FA core complex-dependent FANCD2 ubiquitination in a manner that is secondary to PCNA mono-ubiquitination. PMID: 20675655
  37. RAD18-dependent recruitment of SNM1A to DNA repair complexes by a ubiquitin-binding zinc finger PMID: 20385554
  38. there is no relation between Rad18 SNP and lung cancer development. PMID: 19630985
  39. hRad18 is a novel interacting partner of HIV-1 integrase; role for post-replication/translesion DNA repair in the retroviral integration process. PMID: 12016221
  40. action at DNA replication forks PMID: 12856420
  41. Together, our results suggest that MMS-induced accumulation of hRad18 protein at stalled forks involves protein phosphorylation which may be performed by S-phase checkpoint kinases. PMID: 15381075
  42. the amount of Rad18 in the nucleus is regulated differentially by mono- and polyubiquitination PMID: 15509568
  43. We found that the RAD18 transcript is expressed ubiquitously in various tissues and very highly in the testis in mammals. PMID: 16098139
  44. Association of Polkappa with PCNA is regulated by Rad18-mediated PCNA ubiquitination. PMID: 16611994
  45. Rad18 is a polypeptide associated with Poleta. The study results suggest that arrested replication forks strengthen interactions among Poleta, Rad18/Rad6 and Rev1, consistent with the requirement for effective TLS by Poleta at sites of DNA lesions. PMID: 16824193
  46. RAD18-/- cells were defective in single-strand break repair, but functional for double-strand break repair. PMID: 17158148
  47. Higher-eukaryotic cells separately employ PARP1 and Rad18 to suppress the toxic effects of NHEJ during the HR reaction at stalled replication forks. PMID: 17242200
  48. WRN functions in a RAD18-dependent damage avoidance pathway. PMID: 17541157
  49. RAD18 Arg302Gln polymorphism is associated with non-small-cell lung cancer PMID: 17624554
  50. Single nucleotide polymorphism in the RAD18 gene is associated with colorectal cancer PMID: 17914568

Show More

Hide All

Subcellular Location
Nucleus. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome.
Protein Families
RAD18 family
Database Links

HGNC: 18278

OMIM: 605256

KEGG: hsa:56852

STRING: 9606.ENSP00000264926

UniGene: Hs.375684

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*