Recombinant Human E3 ubiquitin-protein ligase parkin(PRKN)

Code	CSB-EP017451HU
Size	US$1726
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Product Details
Related Products
Q&A and Customer Reviews
Target Data

Product Details

Purity	Greater than 90% as determined by SDS-PAGE.
Target Names	PRKN
Uniprot No.	O60260
Research Area	Apoptosis
Alternative Names	Parkinson juvenile disease protein 2 ;Parkinson disease protein 2
Species	Homo sapiens (Human)
Source	E.coli
Expression Region	1-465aa
Target Protein Sequence	MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIVQRPWRKGQEMNATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGFAFCRECKEAYHEGECSAVFEASGTTTQAYRVDERAAEQARWEAASKETIKKTTKPCPRCHVPVEKNGGCMHMKCPQPQCRLEWCWNCGCEWNRVCMGDHWFDV Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight	67.6kDa
Protein Length	Full Length
Tag Info	N-terminal 6xHis-SUMO-tagged
Form	Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs	Protein FAQs
Storage Condition	Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time	Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA	Please contact us to get it.
Still Have Questions?	Leave a Message or Start an on-line Chat

Q&A and Customer Reviews

■ Q&A

I have some questions for your Recombinant Human E3 ubiquitin-protein ligase parkin protein (cat#: CSB-EP017451HU)- 0.2mg (E. coli) :
1)Is this protein from refined supernatant or inclusion bodies from E. coli?
2)Can you offer tag removal for this protein?

Very nice to receive your inquiry.
This protein is the inclusion bodies from E. coli, but we can guarantee that the protein will be provided in soluble form after refolding even if it's expressed in inclusion bodies form.
In theory, the final protein provided is properly folded. If you need the protein expressed in supernatant , we can try to optimize the condition, and conduct supernatant expression, but we still can't 100% guarantee.
Why do you focus on this question ? Do you want to know the activity of this protein or for some other reasons ? If it's just considered from the activity aspect, you can consider the eukaryotic expressed protein (the activity is more likely but not 100 % guaranteed to be active), we have already successfully expressed the BP and MP proteins before, you can consider to purchase eukaryotic expressed protein.
Sorry, we haven't removed the tag of these proteins before, neither for the EP protein.
Please remark your requirement for tag removal if you need the untagged protein or tag removal when placing the order. We can try enzyme digestion, but we can't guarantee 100% successfully.
The overall success rate of enzyme digestion data analysis is 75%-86%.
Not all protein tags can be removed as some proteins will be very unstable after tag removal.
If we succeed in removing the tag, we will charge for extra cost.
If we fail in removing the tag, we won’t charge for tag removal and provide the fusion protein, and remark this information in datasheet as follows
“Note: The laboratory determined that the Tag on your protein could not be removed with standard laboratory procedures. Your protein is being supplied with the Tag intact.”
Generally, the delivery time will be extended for 3 days.

■ Customer Reviews

Submit CUSABIO Product Reciew in 2 Minutes, Win An Apple Watch!

Target Data

Function	Functions within a multiprotein E3 ubiquitin ligase complex, catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins, such as BCL2, SYT11, CCNE1, GPR37, RHOT1/MIRO1, MFN1, MFN2, STUB1, SNCAIP, SEPT5, TOMM20, USP30, ZNF746 and AIMP2
Involvement in disease	Parkinson disease (PARK); Parkinson disease 2 (PARK2)
Subcellular Location	Cytoplasm, cytosol, Nucleus, Endoplasmic reticulum, Mitochondrion
Protein Families	RBR family, Parkin subfamily
Tissue Specificity	Highly expressed in the brain including the substantia nigra. Expressed in heart, testis and skeletal muscle. Expression is down-regulated or absent in tumor biopsies, and absent in the brain of PARK2 patients. Overexpression protects dopamine neurons fro
Database Links	HGNC: 8607 OMIM: 168600 KEGG: hsa:5071 STRING: 9606.ENSP00000355865 UniGene: Hs.132954