Recombinant Human Epididymal secretory glutathione peroxidase (GPX5)

In Stock
Code CSB-EP009870HUc0
Abbreviation Recombinant Human GPX5 protein
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Epididymis-specific glutathione peroxidase-like protein
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-100aa
Target Protein Sequence
MTTQLRVVHLLPLLLACFVQTSPKQEKMKMDCHKDEKGTIYDYEAIALNKNEYVSFKQYVGKHILFVNVATYCGLTAQYPGMSVQGEDLYLVSSFLRKGM
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
42.9 kDa
Protein Length
Full Length of Isoform 2
Tag Info
N-terminal 6xHis-GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Epididymal secretory glutathione peroxidase (GPX5) is produced in E. coli and features an N-terminal 6xHis-GST tag that makes purification straightforward. This full-length Isoform 2 protein contains amino acids 1-100 and shows a purity level greater than 85% as determined by SDS-PAGE. This product is intended for research use only and is not suitable for diagnostic or therapeutic applications.

Epididymal secretory glutathione peroxidase (GPX5) is an antioxidant enzyme that appears to play a crucial role in protecting cells from oxidative stress by reducing lipid hydroperoxides and hydrogen peroxide. It belongs to the glutathione peroxidase family, which seems integral to cellular defense mechanisms against reactive oxygen species. GPX5 may be particularly relevant in reproductive biology, where it's involved in maintaining the integrity of sperm cells.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Biochemical Characterization and Enzyme Kinetics Studies

This recombinant GPX5 protein can be used to investigate the fundamental biochemical properties of human epididymal secretory glutathione peroxidase. This includes substrate specificity, optimal pH and temperature conditions, and cofactor requirements. The N-terminal His-GST tag makes purification and immobilization easier for detailed kinetic analyses. Researchers might compare the enzymatic properties of this truncated form (1-100aa) with full-length GPX5 to understand structure-function relationships. The high purity level (>85%) makes it suitable for quantitative biochemical assays and mechanistic studies.

2. Antibody Development and Validation

The recombinant GPX5 protein serves as an excellent immunogen and standard for developing specific antibodies against human GPX5. The His-GST tag allows easy purification and quantification for consistent antibody production protocols. Researchers can use this protein to validate antibody specificity, determine binding affinities, and establish detection limits in various immunoassays. The defined protein sequence and purity appear ideal for generating both polyclonal and monoclonal antibodies for subsequent research applications.

3. Protein-Protein Interaction Studies

The dual His-GST tag system makes this recombinant GPX5 particularly well-suited for pull-down assays to identify potential binding partners or interacting proteins in epididymal tissue extracts or other relevant biological samples. The GST tag allows for glutathione-based affinity purification while the His tag provides an alternative purification strategy and detection method. Researchers can investigate how GPX5 may interact with other antioxidant enzymes, structural proteins, or regulatory molecules in the male reproductive system.

4. Comparative Structural and Functional Analysis

This truncated GPX5 construct (1-100aa) can be used in comparative studies to understand the functional domains and structural requirements of glutathione peroxidase family members. Researchers might analyze how this N-terminal region contributes to overall protein stability, folding, and potential catalytic activity compared to other GPX isoforms. The recombinant protein enables detailed biophysical characterization including circular dichroism spectroscopy, dynamic light scattering, and thermal stability analyses to understand the structural properties of this specific GPX5 region.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione. May constitute a glutathione peroxidase-like protective system against peroxide damage in sperm membrane lipids.
Subcellular Location
Secreted.
Protein Families
Glutathione peroxidase family
Tissue Specificity
Epididymis.
Database Links

HGNC: 4557

OMIM: 603435

KEGG: hsa:2880

STRING: 9606.ENSP00000392398

UniGene: Hs.248129

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*