Recombinant Human Epididymal secretory glutathione peroxidase (GPX5)

In Stock
Code CSB-EP009870HUc0
Abbreviation Recombinant Human GPX5 protein
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Epididymis-specific glutathione peroxidase-like protein
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-100aa
Target Protein Sequence
MTTQLRVVHLLPLLLACFVQTSPKQEKMKMDCHKDEKGTIYDYEAIALNKNEYVSFKQYVGKHILFVNVATYCGLTAQYPGMSVQGEDLYLVSSFLRKGM
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
42.9 kDa
Protein Length
Full Length of Isoform 2
Tag Info
N-terminal 6xHis-GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Epididymal secretory glutathione peroxidase (GPX5) is produced in E. coli and features an N-terminal 6xHis-GST tag that makes purification straightforward. This full-length Isoform 2 protein contains amino acids 1-100 and shows a purity level greater than 85% as determined by SDS-PAGE. This product is intended for research use only and is not suitable for diagnostic or therapeutic applications.

Epididymal secretory glutathione peroxidase (GPX5) is an antioxidant enzyme that appears to play a crucial role in protecting cells from oxidative stress by reducing lipid hydroperoxides and hydrogen peroxide. It belongs to the glutathione peroxidase family, which seems integral to cellular defense mechanisms against reactive oxygen species. GPX5 may be particularly relevant in reproductive biology, where it's involved in maintaining the integrity of sperm cells.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant human GPX5 protein is unlikely to be correctly folded or bioactive. Several critical factors contribute to this assessment: 1) GPX5 is a selenocysteine-containing enzyme that requires specific translational machinery for proper incorporation of selenocysteine at the active site - this cannot be achieved in standard E. coli expression systems; 2) The N-terminal 6xHis-GST tag is exceptionally large (~26 kDa for GST plus His-tag) compared to the GPX5 domain (∼11 kDa, 1-100aa), which will likely cause severe steric hindrance and prevent proper folding; 3) The protein represents a truncated form (1-100aa) that may lack critical C-terminal regions necessary for full enzymatic activity; 4) Glutathione peroxidases require specific redox conditions for proper disulfide bond formation and active site configuration that E. coli may not provide. The >85% purity indicates minimal contaminants, but doesn't overcome these fundamental limitations.

This recombinant protein can generate antibodies, but they will primarily recognize the immunodominant GST tag rather than GPX5-specific epitopes. If the protein is misfolded (likely due to the expression system and large tag), antibodies may not recognize native GPX5. For specific antibodies, use properly folded, tag-free GPX5 expressed in a eukaryotic system and validate against the endogenous protein.

This recombinant GPX5 has fundamental limitations that preclude its use for most proposed applications. For reliable results: 1) Use a eukaryotic expression system (mammalian or insect cells) that supports selenocysteine incorporation for any enzymatic or functional studies; 2) Remove the GST tag and use only a small affinity tag for structural and interaction studies; 3) Use full-length GPX5 rather than the truncated form; 4) Always include positive controls with known enzymatic activity when testing GPX function. For antibody production, consider alternative antigens or validate extensively against native GPX5. The current protein may only be suitable for tag-specific antibody generation or as a negative control in limited applications.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione. May constitute a glutathione peroxidase-like protective system against peroxide damage in sperm membrane lipids.
Subcellular Location
Secreted.
Protein Families
Glutathione peroxidase family
Tissue Specificity
Epididymis.
Database Links

HGNC: 4557

OMIM: 603435

KEGG: hsa:2880

STRING: 9606.ENSP00000392398

UniGene: Hs.248129

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*