Recombinant Human Extracellular serine/threonine protein kinase FAM20C (FAM20C), partial

In Stock
Code CSB-MP816901HU1
Abbreviation Recombinant Human FAM20C protein, partial
MSDS
Size $138
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
FAM20C
Uniprot No.
Research Area
Developmental Biology
Alternative Names
Dentin matrix protein 4
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
354-565aa
Target Protein Sequence
FISPANNICFYGECSYYCSTEHALCGKPDQIEGSLAAFLPDLSLAKRKTWRNPWRRSYHKRKKAEWEVDPDYCEEVKQTPPYDSSHRILDVMDMTIFDFLMGNMDRHHYETFEKFGNETFIIHLDNGRGFGKYSHDELSILVPLQQCCRIRKSTYLRLQLLAKEEYKLSLLMAESLRGDQVAPVLYQPHLEALDRRLRVVLKAVRDCVERNG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
29.9 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Extracellular serine/threonine protein kinase FAM20C is produced in a mammalian expression system, which appears to ensure proper folding and post-translational modifications. This partial protein covers amino acids 354 to 565. It's tagged with an N-terminal 10xHis-tag and a C-terminal Myc-tag for easier purification and detection. The product shows purity greater than 85%, as verified by SDS-PAGE, making it suitable for various biochemical assays and research applications.

FAM20C is a serine/threonine protein kinase that plays a crucial role in the phosphorylation of extracellular proteins. It's known for its involvement in biomineralization processes and regulating the secretion of phosphoproteins. As a key component of the secretory pathway, FAM20C modulates the phosphorylation status of proteins, influencing numerous biological pathways. This makes it an important target for research in cellular signaling and disease mechanisms.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

The recombinant human FAM20C fragment (354–565aa), expressed in mammalian cells with N-terminal 10xHis and C-terminal Myc tags, represents a partial segment of the full-length kinase, which spans approximately 584 amino acids. This region lies within the core catalytic domain of FAM20C, an extracellular serine/threonine kinase responsible for phosphorylating secreted proteins. Because the fragment originates from a mammalian expression system, it is likely to undergo correct folding and glycosylation, ensuring near-native conformation. However, since the fragment does not include the complete catalytic domain (lacking N-terminal residues that contribute to ATP binding and substrate recognition), it is unlikely to retain full enzymatic activity. Therefore, the protein is probably well-folded structurally but catalytically inactive or only partially active. It remains suitable for structural, antibody, and binding studies, but not for reliable kinase activity assays without validation.

1. Protein-Protein Interaction Studies

This dual-tagged FAM20C fragment (354–565aa) can be applied in pull-down or affinity-based assays to identify potential interacting proteins that bind within this region of FAM20C. If properly folded—as expected from mammalian expression—it may preserve native-like interaction surfaces, allowing meaningful mapping of partial binding interfaces. If the fragment lacks structural integrity or the N-terminal interaction determinants, it can still serve for screening studies or linear epitope-based binding assays, though such results would need cautious interpretation. Overall, it is useful for preliminary interaction screening but not for reconstructing full enzymatic interaction networks.

2. Antibody Development and Validation

This recombinant fragment is suitable as an antigen for generating antibodies against the 354–565aa region of human FAM20C. If correctly folded, antibodies may recognize native epitopes of the kinase domain, making them valuable for immunostaining or immunoprecipitation. If folding deviates, antibodies would instead recognize linear epitopes, which are still suitable for Western blot and ELISA detection. The dual-tag design facilitates both purification and validation during antibody development and ensures straightforward quality control of immunogens.

3. Structural and Biochemical Characterization

This FAM20C fragment may be used for biophysical and structural characterization of the kinase region. If folded properly, it could serve in CD spectroscopy, DLS, and limited proteolysis to examine secondary structure content and domain stability. If the protein lacks catalytic residues, it remains useful for folding and conformation studies but not for functional enzymatic characterization. The mammalian expression system provides a strong foundation for studying native-like folding, even if activity is lost due to truncation.
Thus, this application requires explicit experimental confirmation of activity before functional interpretation.

Final Recommendation & Action Plan

The recombinant FAM20C fragment expressed in mammalian cells is structurally reliable but catalytically incomplete. Its folding is likely accurate, making it suitable for antibody generation, interaction mapping, and structural or stability assays. However, due to the truncation within the kinase domain, it should not be used as an active kinase without functional validation. Employ this protein for binding and structural characterization, validate folding via CD or limited proteolysis, and only use it in in vitro kinase assays as a test construct with clear caveats about potential inactivity. For catalytic or mechanistic studies, use full-length or extended constructs encompassing the complete kinase domain.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Golgi serine/threonine protein kinase that phosphorylates secretory pathway proteins within Ser-x-Glu/pSer motifs and plays a key role in biomineralization of bones and teeth. Constitutes the main protein kinase for extracellular proteins, generating the majority of the extracellular phosphoproteome. Mainly phosphorylates proteins within the Ser-x-Glu/pSer motif, but also displays a broader substrate specificity. Phosphorylates casein as well as a number of proteins involved in biomineralization such as AMELX, AMTN, ENAM and SPP1. In addition to its role in biomineralization, also plays a role in lipid homeostasis, wound healing and cell migration and adhesion.
Gene References into Functions
  1. that FAM20C may affect the biomineralization by the means more than local phosphorylation of extracellular matrix proteins and systemic phosphorus homeostasis PMID: 28926103
  2. Histidine-rich Ca-binding protein (HRC) was phosphorylated by family with sequence similarity 20C (Fam20C) both in vitro and in vivo. PMID: 28784772
  3. These results suggest that TET1 potentially promotes the cytodifferentiation potential of human dental pulp cells through its DNA demethylation machinery and upregulation of FAM20C protein expression. PMID: 29277934
  4. findings clarify FAM20C's role in hard tissue formation and mineralization, and show that Raine syndrome is congenital sclerosing osteomalacia with cerebral calcification. PMID: 27862258
  5. Alterations of Fam20C activity, promoted by myriocin and sphingolipids, are not accompanied by any significant change in Fam20C protein. These data provide the proof of concept that Fam20C activity is under the control of sphingolipid signaling PMID: 28236661
  6. Our report reinforces that Raine syndrome is compatible with life, and that mild hypophosphatemia and amelogenesis imperfecta are key features of the attenuated form. PMID: 27667191
  7. The Fam20C-and VLK-family of kinases mediate the phosphorylation of proteins in the secretory pathway and extracellular space.Mutation in several secretory pathway kinases cause human disease PMID: 25862977
  8. by treating Fam20C expressing HEK293T cells with myriocin, a potent inhibitor of the sphingosine biosynthetic pathway, the activity of Fam20C released into the conditioned medium is substantially decreased corroborating the concept that sphingosine PMID: 25936777
  9. Using CRISPR/Cas9 genome editing, mass spectrometry, and biochemistry, study identifies more than 100 secreted phosphoproteins as genuine Fam20C substrates; further, study shows that Fam20C exhibits broader substrate specificity than previously appreciated. PMID: 26091039
  10. phenotype in two families with non-lethal Raine syndrome with FAM20C mutations PMID: 25928877
  11. Findings suggest that certain homozygous FAM20C mutations can cause FGF23-related hypophosphatemic osteomalacia and indicate the multiple roles of FAM20C in bone. PMID: 24982027
  12. Results suggest that FAM20C suppresses FGF23 production by enhancing DMP1 expression, and inactivating mutations in FAM20C cause FGF23-related hypophosphatemia by decreasing transcription of DMP1. PMID: 25026495
  13. We report on a child who is homozygous for a 487-kb deletion in 7p22.3 that contains FAM20C PMID: 24039075
  14. Fam20C phosphorylates FGF23, which promotes FGF23 proteolysis by furin by blocking O-glycosylation by polypeptide N-acetylgalactosaminyltransferase 3. PMID: 24706917
  15. mutations in FAM20C provide a putative new mechanism in human subjects leading to dysregulated FGF23 levels, hypophosphatemia, hyperphosphaturia, dental anomalies, intracerebral calcifications and osteosclerosis of the long bones PMID: 23325605
  16. Our results identify FAM20C as a kinase for secreted phosphoproteins and establish a biochemical basis for Raine syndrome. PMID: 22900076
  17. Fam20C appears to be the Golgi casein kinase that phosphorylates secretory pathway proteins within S-x-E motifs; Fam20C phosphorylates caseins and several secreted proteins implicated in biomineralization; mutations in Fam20C cause an osteosclerotic bone dysplasia known as Raine syndrome PMID: 22582013
  18. Osteosclerotic bone dysplasia in siblings with a Fam20C mutation PMID: 20825432
  19. This study defines the causative role of FAM20C in this lethal osteosclerotic disorder and its crucial role in normal bone development. PMID: 17924334
  20. Mutation of FAM20C does not always lead to the infantile lethality previously seen as a prerequisite for Raine syndrome diagnosis. PMID: 19250384

Show More

Hide All

Involvement in disease
Raine syndrome (RNS)
Subcellular Location
Secreted. Golgi apparatus.
Protein Families
FAM20 family
Tissue Specificity
Widely expressed.
Database Links

HGNC: 22140

OMIM: 259775

KEGG: hsa:56975

STRING: 9606.ENSP00000322323

UniGene: Hs.134742

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*