Recombinant Human F-box only protein 48 (FBXO48)

In Stock
Code CSB-EP702041HU
Abbreviation Recombinant Human FBXO48 protein
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
FBXO48
Uniprot No.
Research Area
Others
Alternative Names
FBXO48; FBX48F-box only protein 48
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-155aa
Target Protein Sequence
MHKNSKRNNNLRVSHTEANSVDAEKEKNESQNNFFELLPAEITFKIFSQLDIRSLCRASLTCRSWNDTIRNSDSLWKPHCMTVRAVCRREIDDDLESGYSWRVILLRNYQKSKVKHEWLSGRYSNICSPISLPEKIMYPMDADTWGEILEAELER
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
25.7 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human F-box only protein 48 (FBXO48) is expressed in E. coli, spanning the complete protein sequence from amino acids 1-155. The construct includes an N-terminal 10xHis tag and a C-terminal Myc tag, which streamline purification and detection processes. SDS-PAGE analysis confirms the protein achieves greater than 90% purity, suggesting strong reliability for research applications. This protein is strictly for research use and should not be applied for diagnostic or therapeutic purposes.

FBXO48 belongs to the F-box protein family, which appears to play a crucial role in the ubiquitin-proteasome system. These F-box proteins act as essential components of the SCF (SKP1-Cullin-F-box) complex, where they function as substrate recognition units. Through its role in protein degradation, FBXO48 likely contributes to cellular processes including cell cycle regulation and signal transduction. This makes it a compelling target for researchers studying cellular homeostasis and related pathways.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Human FBXO48 is an F-box protein that requires precise folding and proper integration into the SKP1-CUL1-F-box protein (SCF) complex for its ubiquitin ligase activity. The E. coli expression system cannot provide the necessary eukaryotic post-translational modifications and chaperone systems required for this complex protein. The dual N-terminal 10xHis-tag and C-terminal Myc-tag may sterically interfere with the protein's functional domains and complex formation interfaces. While the protein may be soluble, it is highly unlikely to achieve the correct folding needed for functional activity in ubiquitin ligase complexes.

1. Antibody Development and Validation

This recombinant FBXO48 serves as an excellent immunogen for generating antibodies against linear epitopes of human FBXO48. The full-length sequence ensures comprehensive epitope coverage. The dual tags facilitate purification and provide additional epitopes for screening. However, antibodies may not efficiently recognize conformational epitopes on the native, properly folded FBXO48 in cellular contexts.

2. Biochemical Characterization and Stability Studies

This is the essential first step to assess the protein's physical properties. Techniques like size-exclusion chromatography can determine oligomeric state, while circular dichroism can analyze secondary structure content and thermal stability. These studies provide critical quality control data but characterize this protein itself, not native FBXO48.

3. ELISA-Based Quantitative Assays

This protein is well-suited as a standard for quantitative ELISA to detect immunoreactive FBXO48 levels. The assay depends on antibody binding to linear epitopes, so the protein's folding state is less critical. The dual tags enable flexible immobilization and detection strategies for reliable standard curve generation.

Final Recommendation & Action Plan

The E. coli expression system is fundamentally unsuitable for producing a functional version of this complex F-box protein, limiting its applications to non-functional uses. The immediate priority is Application 2 (Biochemical Characterization) to assess the protein's physical properties through SEC and CD spectroscopy. Applications 1 and 3 (Antibody Development and ELISA) can proceed immediately. F-box protein interactions require precise tertiary structure and complex formation capabilities that this bacterially expressed FBXO48 cannot provide. For functional FBXO48 studies, use mammalian expression systems that support proper complex formation and post-translational modifications.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*