Recombinant Human F-box only protein 48 (FBXO48)

In Stock
Code CSB-EP702041HU
Abbreviation Recombinant Human FBXO48 protein
MSDS
Size $306
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
FBXO48
Uniprot No.
Research Area
Others
Alternative Names
FBXO48; FBX48F-box only protein 48
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-155aa
Target Protein Sequence
MHKNSKRNNNLRVSHTEANSVDAEKEKNESQNNFFELLPAEITFKIFSQLDIRSLCRASLTCRSWNDTIRNSDSLWKPHCMTVRAVCRREIDDDLESGYSWRVILLRNYQKSKVKHEWLSGRYSNICSPISLPEKIMYPMDADTWGEILEAELER
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
25.7 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human F-box only protein 48 (FBXO48) is expressed in E. coli, spanning the complete protein sequence from amino acids 1-155. The construct includes an N-terminal 10xHis tag and a C-terminal Myc tag, which streamline purification and detection processes. SDS-PAGE analysis confirms the protein achieves greater than 90% purity, suggesting strong reliability for research applications. This protein is strictly for research use and should not be applied for diagnostic or therapeutic purposes.

FBXO48 belongs to the F-box protein family, which appears to play a crucial role in the ubiquitin-proteasome system. These F-box proteins act as essential components of the SCF (SKP1-Cullin-F-box) complex, where they function as substrate recognition units. Through its role in protein degradation, FBXO48 likely contributes to cellular processes including cell cycle regulation and signal transduction. This makes it a compelling target for researchers studying cellular homeostasis and related pathways.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Protein-Protein Interaction Studies Using Pull-Down Assays

The dual-tagged design of FBXO48—with both N-terminal His-tag and C-terminal Myc-tag—opens up comprehensive protein interaction mapping through pull-down experiments. Researchers can immobilize the protein on nickel-affinity resins via the His-tag to capture potential binding partners from cell lysates or purified protein libraries. Meanwhile, the Myc-tag offers an additional detection route for Western blot confirmation and may serve as an alternative capture method using anti-Myc antibodies. This dual-tag approach provides experimental flexibility and built-in validation opportunities when hunting for novel FBXO48 interacting proteins.

2. Antibody Development and Validation

The high-purity recombinant FBXO48 protein (>90% pure) makes an excellent immunogen for creating specific antibodies against this F-box protein. Since the full-length construct (1-155aa) retains native epitopes found in endogenous FBXO48, it appears well-suited for producing antibodies with physiological relevance. Both polyclonal and monoclonal antibody development can take advantage of this purified protein. The dual tags also provide convenient built-in controls for specificity testing and cross-reactivity assessment during antibody characterization.

3. Biochemical Characterization and Stability Studies

Purified FBXO48 protein allows for detailed biochemical analysis, including thermal stability profiling, pH tolerance testing, and buffer optimization studies. These experiments can help establish optimal storage and handling conditions while revealing insights into the protein's biophysical properties. The dual-tag system enables consistent protein detection and quantification throughout stability studies—researchers can choose between His-tag detection or Myc-tag immunodetection methods depending on their experimental needs.

4. ELISA-Based Quantitative Assays

The Myc-tagged FBXO48 protein can be adapted to develop sandwich or competitive ELISA assays for research applications. The Myc epitope provides a dependable detection mechanism using commercially available anti-Myc antibodies, while the protein can be immobilized either through its His-tag or through direct coating methods. Such assays might prove valuable for screening compound libraries or investigating factors that influence FBXO48 levels in experimental systems.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*