Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

FCN3

Uniprot No.

O75636

Research Area

Immunology

Alternative Names

FCN3; FCNH; HAKA1; Ficolin-3; Collagen/fibrinogen domain-containing lectin 3 p35; Collagen/fibrinogen domain-containing protein 3; Hakata antigen

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

24-299aa

Target Protein Sequence

QEHPSCPGPRELEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGDPVNLLRCQEGPRNCRELLSQGATLSGWYHLCLPEGRALPVFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQLALGKFSEGTAGDSLSLHSGRPFTTYDADHDSSNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKYGIDWASGRGVGHPYRRVRMMLR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

34.4 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Amino acids 24-299 constitute the expression domain of recombinant Human FCN3. This FCN3 protein is theoretically predicted to have a molecular weight of 34.8 kDa. The FCN3 protein was expressed in e.coli. The FCN3 gene fragment has been modified by fusing the C-terminal 6xHis tag, providing convenience in detecting and purifying the recombinant FCN3 protein during the following stages.

Human ficolin-3 (FCN3) is a soluble pattern recognition receptor involved in the innate immune system. It belongs to the collectin family and plays a crucial role in recognizing and binding to microbial pathogens. FCN3 is primarily known for its ability to initiate the lectin complement pathway, leading to the activation of the immune response against invading microorganisms. Beyond its role in immunity, FCN3 has been associated with various diseases, including autoimmune disorders and infectious diseases. Research on FCN3 spans immunology, infectious diseases, and host-pathogen interactions, contributing to a deeper understanding of the innate immune response and potential therapeutic strategies for immune-related conditions.

Target Background

Function

May function in innate immunity through activation of the lectin complement pathway. Calcium-dependent and GlcNAc-binding lectin. Has affinity with GalNAc, GlcNAc, D-fucose, as mono/oligosaccharide and lipopolysaccharides from S.typhimurium and S.minnesota.

Gene References into Functions

increased SFRP4 and ficolin-3 levels are significantly associated with gestational diabetes mellitus development and might be important risk factors for this pregnancy complication. PMID: 29491225
Study found the ratio of ficolin-3/adiponectin at 16-18 weeks of gestation was changed in pregnant women who subsequently developed gestational diabetes mellitus GDM, and might provide effective early predicting and screening for GDM. PMID: 28445618
Ficolin-3 was overexpressed in the serum of most hepatocellular carcinoma patients after Radiofrequency ablation . Ficolin-3 might be a biomarker for Radiofrequency ablation treatment efficacy and a potential target for hepatocellular carcinoma immunotherapy. PMID: 29386009
Serum H-ficolin levels inversely correlated with ground-glass opacity score on chest computed tomography in systemic sclerosis-interstitial lung disease (SSc-ILD) patients. H-ficolin-related innate immunity may be involved in SSc-ILD development. PMID: 28432700
Ficolin-3 plasma levels are associated with the presence and progression of abdominal aortic aneurysm (AAA), suggesting its potential role as a biomarker of AAA PMID: 28039962
results suggest that anti-ficolin-3 antibodies could be useful for the diagnosis of active nephritis in SLE patients PMID: 27631981
this study shows that H-ficolin may aid clearance of influenza A virus by promoting monocyte uptake of the virus, while reducing viral replication and virus-induced TNF-a responses in these cells PMID: 27856789
These results suggest that polymorphisms in the FCN3 gene cooperate to increase ficolin-3 concentration and that it might contribute to leprosy susceptibility by favoring Mycobacterium leprae infection. PMID: 28241035
subjects that were heterozygote carriers of both FCN2 + 6424 and FCN3 + 1637delC were sufficient mannan-binding lectin producers PMID: 26795763
in patients with systemic lupus erythematosus, there was no significant association between ficolin-1 and ficolin-3 with lupus nephritis PMID: 27981461
Monitoring serum H-ficolin levels was shown to be of no benefit in terms of predicting severe infection. PMID: 26377840
Serum levels of ficolin-2 and ficolin-3 were significantly lower in the cardiac syndrome X patients compared to controls. PMID: 27312152
LPS induces a tissue-specific recruitment of ficolin-3 and ficolin-1 in the lung and systemic compartment, respectively, suggesting an important role of distinct lectin complement pathway initiators in the local pulmonary and systemic host defence. PMID: 26868430
Lower serum ficolin-3 levels were correlated with injury severity following traumatic brain injury. PMID: 26627059
this study provide novel insight in the binding and complement activating capacity of the lectin pathway initiation molecules ficolin-2 and ficolin-3 towards relevant Gram-negative pathogens of pathophysiological relevance. PMID: 26074063
Data indicate differences in the plasma concentrations of collectin liver 1 and collectin kidney 1, M-ficolin and H-ficol in systemic lupus erythematosus (SLE) patients compared to a group of healthy controls. PMID: 26154564
H-ficolin participates in A. fumigatus defence through the activation of the lectin complement pathway, enhanced fungus-host interactions and modulated immune responses. PMID: 26133042
data suggest that high levels of the complement activating molecule H-ficolin are associated with an increased risk of future progression to microalbuminuria in patients with newly diagnosed type 1 diabetes. PMID: 25064124
High ficolin-3 level at the time of transplantation was an independent significant risk factor for shorter graft survival. PMID: 25222012
There is lack of association of serum mannose-binding lectin or ficolins with complement activation in patients with antiphospholipid antibodies. PMID: 25083730
This study aims to investigate whether an association exists between the ficolins that are part of the lectin complement pathway and systemic lupus erythematosus. PMID: 25069872
Both ficolin-3 and MASP-2 levels correlated inversely with the time from the onset of the attack of hereditary angioedema until blood sampling PMID: 25042985
Data show that the plasmid pETb-ficolin 3 was cloned successfully and the purity of the protein His-ficolin 3 was over 90%. PMID: 25001927
Data show that the expression of ficolin-3(FCN3) in ovarian cancer (OC) was inversely correlated with serum ficolin-3 and lower in comparison with controls. PMID: 23744477
low levels of ficolin-3 are associated with advanced heart failure and outcome. The decrease of ficolin-3 was associated with increased complement activation. PMID: 23596511
Increased fucosylation of ficolin 3 in plasma of the rheumatoid arthritis patients PMID: 23107985
Survival analyses showed that high pre-transplant serum levels of FCN3 were associated with decreased graft survival, suggesting an important role of FCN3 in the pathophysiology of kidney graft rejection PMID: 23416240
Data indicate that the median concentration of MASP-2/ficolin-3 complexes was 119.7 AU/ml (range: 2.9-615.5 AU/ml). PMID: 23142462
Both pre-term deliveries and low birth weight (independently of gestational age) were significantly associated with low H-ficolin concentrations but not with heterozygosity for the FCN3 1637delC frameshift mutation. PMID: 22226667
Found that a common variant of FCN3/CD164L2 is associated with hypertension in Chinese population. PMID: 22471352
H-ficolin has antiviral activity against influenza A virus (IAV). H-ficolin also fixes complement to a surface coated with IAV. PMID: 22851708
The purpose of this study was to determine whether circulating levels of ficolin-2 and ficolin-3 are altered in normal pregnancy and pre-eclampsia. PMID: 22670778
Cord blood MBL concentrations were significantly lower in intrauterine-growth-restriction (IUGR) cases than controls. No differences in H- and L-ficolin concentrations were observed between groups. PMID: 22082351
in whole serum. MASP-2 was co-purified with H-ficolin, and the purified H-ficolin.MASP-2 complex could activate complement as measured by cleavage of complement factor C4 PMID: 22238349
Data indicate that the deposition of both C4 and C3 showed a significant positive correlation with the serum concentration of Ficolin-3. PMID: 21085669
MBL-associated serine protease-3 down-regulate Ficolin-3 mediated complement activation through the lectin pathway. PMID: 19939495
Hakata antigen, a ficolin associated with MBL-associated serine proteases and small MBL-associated protein, activates the lectin complement pathway. PMID: 11907111
Hakata circulates as Hakata-MASPs complex in the blood, binds Aerococcus viridans polysaccharide and inhibits A. viridans growth PMID: 12367778
The X-ray structures of H-ficolin trimeric recognition domains, alone and in complex with various ligands, have been solved. PMID: 17215869
variations in H-ficolin appear to be of limited importance in the pathogenesis of Crohn's disease PMID: 17303612
Ficolin 3 mediates the clearance of late apoptotic cells, which suggests that this protein is involved in the maintenance of tissue homeostasis and might play a protective role against the development of autoimmunity. PMID: 17469142
Ficolin-3 has a high complement activating potential and is the only collagenase proteolytic resistant molecule among the lectin complement pathway initiators. PMID: 18006063
an FCN3+1637delC deletion variant disrupting the possibility for pattern recognition was detected; characterization of recombinant variant Ficolin-3 shows that homozygosity for the FCN3+1637delC deletion may lead to Ficolin-3 deficiency PMID: 18261799
L-ficolin residue lysine57 is a key component of the interaction with both the mannan-binding lectin (MBL)-associated serine proteases and calreticulin, providing a strong indication that MBL and ficolins share homologous binding sites for their partners. PMID: 19109177
Results suggest that the elevation of S-ficolin-3 and its association with specific manifestations in systemic lupus erythematosus may indicate a pathogenetic role of ficolin-3 in SLE. PMID: 19208603

Hide All

Involvement in disease

Ficolin 3 deficiency (FCN3D)

Subcellular Location

Secreted. Note=Found in blood plasma, bronchus, alveolus and bile duct.

Protein Families

Ficolin lectin family

Tissue Specificity

Liver and lung. In liver it is produced by bile duct epithelial cells and hepatocytes. In lung it is produced by both ciliated bronchial epithelial cells and type II alveolar epithelial cells.

Database Links

HGNC: 3625

OMIM: 604973

KEGG: hsa:8547

STRING: 9606.ENSP00000270879

UniGene: Hs.333383

Code	CSB-EP008552HUc7
Abbreviation	Recombinant Human FCN3 protein
MSDS	MSDS Datasheet
Size	US$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Ficolin-3 (FCN3)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage