Purity
Greater than 85% as determined by SDS-PAGE.
Alternative Names
FCN3; FCNH; HAKA1; Ficolin-3; Collagen/fibrinogen domain-containing lectin 3 p35; Collagen/fibrinogen domain-containing protein 3; Hakata antigen
Species
Homo sapiens (Human)
Expression Region
24-299aa
Target Protein Sequence
QEHPSCPGPRELEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGDPVNLLRCQEGPRNCRELLSQGATLSGWYHLCLPEGRALPVFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQLALGKFSEGTAGDSLSLHSGRPFTTYDADHDSSNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKYGIDWASGRGVGHPYRRVRMMLR
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 24-299 constitute the expression domain of recombinant Human FCN3. This FCN3 protein is theoretically predicted to have a molecular weight of 34.8 kDa. The FCN3 protein was expressed in e.coli. The FCN3 gene fragment has been modified by fusing the C-terminal 6xHis tag, providing convenience in detecting and purifying the recombinant FCN3 protein during the following stages.
Human ficolin-3 (FCN3) is a soluble pattern recognition receptor involved in the innate immune system. It belongs to the collectin family and plays a crucial role in recognizing and binding to microbial pathogens. FCN3 is primarily known for its ability to initiate the lectin complement pathway, leading to the activation of the immune response against invading microorganisms. Beyond its role in immunity, FCN3 has been associated with various diseases, including autoimmune disorders and infectious diseases. Research on FCN3 spans immunology, infectious diseases, and host-pathogen interactions, contributing to a deeper understanding of the innate immune response and potential therapeutic strategies for immune-related conditions.