Code | CSB-EP021915HU |
Size | $1812 |
Image |
|
Have Questions? | Leave a Message or Start an on-line Chat |
Description |
To make this Recombinant Human SNCG protein, the SNCG gene was isolated at first and cloned into an expression vector. CUSABIO has built a mature recombinant protein platform. This Recombinant Human SNCG protein was developed in the platform. It was expressed in E.coli at the region of 1-127aa of the Human SNCG protein. N-terminal 6xHis-SUMO tag was fused with the expression vector for affinity and purification purposes. The purity is 90%+ determined by SDS-PAGE. γ-Synuclein (SNCG) is one member of the synuclein family (α-synuclein, β-synuclein, and SNCG), which was first named breast cancer-specific gene 1 (BCSG1). To date, the overexpression of SNCG has been demonstrated in multiple malignant solid tumors, including breast, ovarian, uterus, liver, and cervical cancers. Besides, SNCG up-regulation is related to tumorigenesis and metastasis. Studies suggest SNCG may be a potential prognostic marker and therapeutic approach to promote cancer progression, but the association of the SNCG overexpression with patient survival is controversial in EOC. Furthermore, one study has reported that SNCG might enhance the migration of ovarian cancer cells by activating small GTPases and ERKs of the RHO family. The results revealed that SNCG up-regulation contributes to the poor clinical outcome of patients with ovarian cancer and highlight the metastasis-promoting function of SNCG via activating the PI3K/Akt signaling pathway in ovarian cancer. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Target Names | SNCG |
Uniprot No. | O76070 |
Research Area | Neuroscience |
Alternative Names |
BCSG1; Breast cancer specific gene 1 protein; Breast cancer specific protein 1; Breast cancer-specific gene 1 protein; Gamma synuclein; Gamma-synuclein; Persyn; PRSN; SNCG; SR; Synoretin; Synuclein gamma; synuclein, gamma (breast cancer-specific protein 1); SYUG_HUMAN
|
Species | Homo sapiens (Human) |
Source | E.coli |
Expression Region | 1-127aa |
Target Protein Sequence | MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Mol. Weight | 29.3kDa |
Protein Length | Full Length |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | 3-7 business days |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Function |
Plays a role in neurofilament network integrity. May be involved in modulating axonal architecture during development and in the adult. In vitro, increases the susceptibility of neurofilament-H to calcium-dependent proteases. May also function in modulating the keratin network in skin. Activates the MAPK and Elk-1 signal transduction pathway.
|
Gene References into Functions |
|
Subcellular Location | Cytoplasm, perinuclear region. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton, spindle. Note=Associated with centrosomes in several interphase cells. In mitotic cells, localized to the poles of the spindle. |
Protein Families | Synuclein family |
Tissue Specificity | Highly expressed in brain, particularly in the substantia nigra. Also expressed in the corpus callosum, heart, skeletal muscle, ovary, testis, colon and spleen. Weak expression in pancreas, kidney and lung. |
Database Links |
HGNC: 11141 OMIM: 602998 KEGG: hsa:6623 STRING: 9606.ENSP00000361087 UniGene: Hs.349470 |