Recombinant Human Gamma-synuclein (SNCG)

In Stock
Code CSB-EP021915HU
Abbreviation Recombinant Human SNCG protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP021915HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) SNCG.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP021915HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) SNCG.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
SNCG
Uniprot No.
Research Area
Neuroscience
Alternative Names
BCSG1; Breast cancer specific gene 1 protein; Breast cancer specific protein 1; Breast cancer-specific gene 1 protein; Gamma synuclein; Gamma-synuclein; Persyn; PRSN; SNCG; SR; Synoretin; Synuclein gamma; synuclein, gamma (breast cancer-specific protein 1); SYUG_HUMAN
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-127aa
Target Protein Sequence
MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAEEAQSGGD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
29.3kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

To make this Recombinant Human SNCG protein, the SNCG gene was isolated at first and cloned into an expression vector. CUSABIO has built a mature recombinant protein platform. This Recombinant Human SNCG protein was developed in the platform. It was expressed in E.coli at the region of 1-127aa of the Human SNCG protein. N-terminal 6xHis-SUMO tag was fused with the expression vector for affinity and purification purposes. The purity is 90%+ determined by SDS-PAGE.

γ-Synuclein (SNCG) is one member of the synuclein family (α-synuclein, β-synuclein, and SNCG), which was first named breast cancer-specific gene 1 (BCSG1). To date, the overexpression of SNCG has been demonstrated in multiple malignant solid tumors, including breast, ovarian, uterus, liver, and cervical cancers. Besides, SNCG up-regulation is related to tumorigenesis and metastasis. Studies suggest SNCG may be a potential prognostic marker and therapeutic approach to promote cancer progression, but the association of the SNCG overexpression with patient survival is controversial in EOC. Furthermore, one study has reported that SNCG might enhance the migration of ovarian cancer cells by activating small GTPases and ERKs of the RHO family. The results revealed that SNCG up-regulation contributes to the poor clinical outcome of patients with ovarian cancer and highlight the metastasis-promoting function of SNCG via activating the PI3K/Akt signaling pathway in ovarian cancer.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a role in neurofilament network integrity. May be involved in modulating axonal architecture during development and in the adult. In vitro, increases the susceptibility of neurofilament-H to calcium-dependent proteases. May also function in modulating the keratin network in skin. Activates the MAPK and Elk-1 signal transduction pathway.
Gene References into Functions
  1. LncRNA-AK058003 can reduce the expression of mRNA stabilizing protein HuR and act as a precursor of miR-15a to suppress gamma-synuclein-mediated cell proliferation and the metastasis of hepatocellular carcinoma. PMID: 28035067
  2. Results demonstrated that urine SNCG can discriminate bladder cancer from urinary diseases, and is a useful prognosticator of postsurgical recurrence. PMID: 27223068
  3. A positive SNCG may serve as a potential marker to identify breast cancer patients who are less likely to benefit from radiotherapy PMID: 27595752
  4. This largest collection of USCs to date demonstrates that SNCG was associated with poor survival in univariate analyses. SNCG does not predict survival outcome independent of p53 and p16 in models that jointly consider multiple markers. PMID: 27926776
  5. SNCG expression in ovarian cancer is frequent in patients with high-risk features, but it does not correlate with chemotherapy response, overall survival, or progression-free survival. PMID: 27809878
  6. High synoretin expression is associated with non-small cell lung cancer. PMID: 27655287
  7. Study shows an overexpression of SNCG in bladder cancer (BC) tissues which correlates positively with neoplasm recurrence. SNCG seems a good marker to predict recurrence of BC, but not a reliable one for staging or prediction of survival rate. PMID: 26976983
  8. down-regulation of gamma-synuclein reduces the protein level of PLCbeta but increases the transcript level over 40 fold PMID: 26521046
  9. the conformational dynamics of ERalpha36 in the absence and presence of Hsp90 and gammaSyn, is reported. PMID: 26299756
  10. SNCG may promote MCF7 cell migration through activating the Erk pathway and breaking cell-cell junctions. PMID: 25997706
  11. Data suggest that both BubR1 and SNCG may be promising predictive marker rather than prognostic marker in patients with breast cancer. PMID: 26191236
  12. High gamma-Synuclein expression is associated with invasiveness in colon adenocarcinoma. PMID: 25956278
  13. Synuclein-gamma shares some, but not all, gene regulators with leptin and is a PPARgamma target in adipocytes but not dorsal root ganglia neurons. PMID: 25756178
  14. These results advance our understanding of the role of lncRNA-AK058003 as a regulator of hypoxia signaling, and this newly identified hypoxia/lncRNA-AK058003/SNCG pathway may help in the development of new therapeutics. PMID: 25499222
  15. SNCG is highly expressed in bladder cancer tissue and its expression is stage-specific, but it is not helpful for predicting outcome in bladder cancer patients. PMID: 25479371
  16. Results indicate that SNCG specifically interacts with Akt and mTOR and protects Akt/mTOR stability and function under stressful conditions when the activity of Hsp90 is blocked. PMID: 24954510
  17. SNCG, MAP2, SDF-1 and CXCR4 may play an important role in the carcinogenesis, progression, invasion and metastasis of gastric adenocarcinoma. PMID: 25400739
  18. Our results are the first to suggest that SNCG is a new independent predictor for poor prognosis in EC patients in the literature. PMID: 25142230
  19. SNCG is actively secreted by cancer cells via an unconventional secretion pathway and contributes to aggressive phenotypes of cancer cells. PMID: 25229320
  20. These data show that SNCG renders AMD resistance by inhibiting BubR1 activity and attenuating SAC function. PMID: 24431077
  21. even though purified gamma-synuclein form oligomers, when binding partners are present, as in cells, it dissociates to a monomer to bind these partners, which in turn may modify protein function and integrity PMID: 24367999
  22. Data indicate that micro-RNAs might provide cell-specific regulation of gamma-synuclein expression. PMID: 24040069
  23. SNCG expression indicates a much poorer prognosis of TNBC. PMID: 23696021
  24. These results provide strong evidence that suggests gamma-synuclein plays a positive role in the progression of colorectal cancer. PMID: 23970348
  25. Gamma-synuclein expression was an independent predictor of the neoadjuvant chemotherapy objective response rate. PMID: 23696593
  26. Serum synuclein-gamma provided a promising diagnostic biomarker for early detection and was a complementary biomarker of carcinoembryonic antigen and/or CA19-9 in gastrointestinal and esophageal cancer. PMID: 22440249
  27. Compared to controls there were lower levels of gamma synuclein in the visual cortex from dementia with Lewy bodies patients. PMID: 23242284
  28. gamma-synuclein has a role in promoting a more robust G protein Galphaq activation of PLCbeta2 PMID: 22905097
  29. Thermodynamic studies in conjunction with EPR confirm that alpha-synuclein, beta-synuclein, and gamma-synuclein bind copper(II) in a high affinity 1:1 stoichiometry. PMID: 21117662
  30. SNCG can serve as a marker for the potential of the tumor cell for the rapid spreading and metastazing of the non-differentiated tumors. PMID: 22294286
  31. SNCG biomarker has independently poor prognostic value for patients with lymph node metastasis. PMID: 22261620
  32. Data from our in vivo study showed a decrease in tumor growth and weight in mice injected with SNCG-silenced NOZ cells. Together, these findings suggest that SNCG plays an important role in the progression of GBC PMID: 22201822
  33. Overexpression of SNCG seemed to be a predictor biomarker for aggressive tumor behavior and adverse outcome in patients with endometrial cancer. PMID: 22015044
  34. gamma-synuclein is a promising new adjunct marker for identifying reactive follicular dendritic cells and for diagnosing follicular dendritic cell sarcoma and benign and malignant vascular tumors. PMID: 21959308
  35. SNCG shRNA effectively suppressed breast cancer cell formation in vivo and may be a useful clinical strategy to control breast cancer. PMID: 21740810
  36. SNCG interacts only with the 18kDa region of Hsp70 substrate binding domain and the TPR motif of BubR1. Based on the interactions of SNCG with N-BubR1 and ANK peptide, the common residues of SNCG that mediate these interactions were identified. PMID: 20437261
  37. The upregulation of gamma-synuclein expression in colorectal cancer is primarily attributed to the demethylation of CpG islands. PMID: 20577925
  38. SNCG overexpression is associated with colon cancer. PMID: 20604972
  39. Results indicate that ER-alpha36 is a new member of the ER-alpha family that mediates membrane-initiated estrogen signaling and that synuclein gamma can replace the function of heat shock protein 90. PMID: 20595634
  40. The reciprocal regulation of gamma-synuclein and IGF-I receptor expression creates a circuit that modulates IGF-I signaling. PMID: 20670935
  41. members of the synuclein gene family, particularly SNCA and SNCG, affect the risk of developing diffuse lewy body disease. PMID: 20697047
  42. Gamma-synuclein protein is valuable for evaluation of progression of colorectal carcinoma; it is more sensitive to predict advanced stage and lymph node invasion when combined with either alpha- or beta-synuclein protein. PMID: 20043104
  43. gamma-synuclein may play a positive role in the progression of colorectal cancer PMID: 19859996
  44. Biophysical properties of the synucleins and their propensities to fibrillate: inhibition of alpha-synuclein assembly by beta- and gamma-synucleins PMID: 11812782
  45. strong evidence that AP1 plays an overriding role in the transcription of the BCSG1 gene and that blockade of AP1 transactivation down-regulates BCSG1 expression and suppresses tumor phenotype PMID: 12072430
  46. role in promoting cancer cell survival and inhibition of stress- and chemotherapy drug-induced apoptosis by modulating MAPK pathways PMID: 12121974
  47. data demonstrated a moderate elevation of matrix metalloproteinases-2 and significant upregulation of matrix metalloproteinases-9 in stable cell lines overexpressing gamma-synuclein PMID: 12559990
  48. Hypomethylation of the synuclein gamma gene CpG island promotes its aberrant expression in breast carcinoma and ovarian carcinoma. PMID: 12566312
  49. In high-grade glial tumors. Found in all anaplastic ependymomas but in only 33% of ependymomas and 16% of myxopapillary ependymomas. In 63% of glioblastomas but not in other astrocytic tumors. No gamma-synuclein in medulloblastomas. PMID: 12783249
  50. SNCG is required for efficient ER-alpha signaling in brest cancer. PMID: 12873981

Show More

Hide All

Subcellular Location
Cytoplasm, perinuclear region. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton, spindle. Note=Associated with centrosomes in several interphase cells. In mitotic cells, localized to the poles of the spindle.
Protein Families
Synuclein family
Tissue Specificity
Highly expressed in brain, particularly in the substantia nigra. Also expressed in the corpus callosum, heart, skeletal muscle, ovary, testis, colon and spleen. Weak expression in pancreas, kidney and lung.
Database Links

HGNC: 11141

OMIM: 602998

KEGG: hsa:6623

STRING: 9606.ENSP00000361087

UniGene: Hs.349470

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*