Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
CD; CELIAC1; DC 1 alpha chain; DC alpha; DC-1 alpha chain; DC-alpha; DC1; included; DQ alpha 1 chain; DQ-A1; DQ-DRW9 alpha chain; DQA1_HUMAN; FLJ27088; FLJ27328; Gluten-sensitive enteropathy (celiac disease); GSE; HLA class II histocompatibility antigen; HLA class II histocompatibility antigen; DQ alpha 1 chain; HLA class II histocompatibility antigen; DQ(W3) alpha chain; HLA-DCA; HLA-DQA; HLA-DQA1; HLA-DQA1 major histocompatibility complex; class II; DQ alpha 1; HLADC histocompatibility type; Immune response antigens HIa; included; leucocyte antigen DQA1 ; leukocyte antigen alpha chain ; LOC100133678; LOC100507686; LOC100509457; Major histocompatibility complex; class II; DQ alpha 1; MGC149527; MHC class II antigen; MHC class II DQA1; MHC class II HLA-D alpha glycoprotein; MHC class II HLA-DQ alpha 1; MHC class II surface glycoprotein; MHC HLA-DQ alpha; OTTHUMP00000029141; OTTHUMP00000176885; OTTHUMP00000178551; OTTHUMP00000178552; OTTHUMP00000233817
Species
Homo sapiens (Human)
Expression Region
24-213aa
Target Protein Sequence
EDIVADHVASYGVNLYQSYGPSGQYTHEFDGDEQFYVDLGRKETVWCLPVLRQFRFDPQFALTNIAVLKHNLNSLIKRSNSTAATNEVPEVTVFSKSPVTLGQPNILICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTLLPSAEESYDCKVEHWGLDKPLLKHWEPEIPAPMSE
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Extracellular Domain
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 24-213 form the expressed segment for recombinant Human HLA-DQA1. The calculated molecular weight for this HLA-DQA1 protein is 25.4 kDa. The HLA-DQA1 protein was expressed in e.coli. The N-terminal 6xHis tag was fused into the coding gene segment of HLA-DQA1, making it easier to detect and purify the HLA-DQA1 recombinant protein in the later stages of expression and purification.
The human HLA class II histocompatibility antigen, DQ alpha 1 chain (HLA-DQA1) is a subunit of the HLA class II complex, which is involved in presenting antigens to immune cells. HLA-DQA1 plays a crucial role in the immune system. HLA-DQA1 is expressed on the surface of antigen-presenting cells, such as dendritic cells, macrophages, and B cells. It interacts with the beta chain (HLA-DQB1) to form a heterodimer, creating a binding groove for the presentation of antigenic peptides to CD4
+ T cells. This process is essential for the activation of the adaptive immune response. Research on HLA-DQA1 focuses on understanding its role in antigen presentation, immune response regulation, and its association with autoimmune diseases and susceptibility to infections.