Recombinant Human Hyaluronan and proteoglycan link protein 4 (HAPLN4)

In Stock
Code CSB-EP010133HU
Abbreviation Recombinant Human HAPLN4 protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
HAPLN4
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Brain link protein 2; BRAL 2; BRAL2; HAPLN 4; Hapln4; HPLN4_HUMAN; Hyaluronan and proteoglycan link protein 4; Hyaluronan and proteoglycan link protein 4 precursor ; KIAA1926
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
30-402aa
Target Protein Sequence
QRGRKKVVHVLEGESGSVVVQTAPGQVVSHRGGTIVLPCRYHYEAAAHGHDGVRLKWTKVVDPLAFTDVFVALGPQHRAFGSYRGRAELQGDGPGDASLVLRNVTLQDYGRYECEVTNELEDDAGMVKLDLEGVVFPYHPRGGRYKLTFAEAQRACAEQDGILASAEQLHAAWRDGLDWCNAGWLRDGSVQYPVNRPREPCGGLGGTGSAGGGGDANGGLRNYGYRHNAEERYDAFCFTSNLPGRVFFLKPLRPVPFSGAARACAARGAAVAKVGQLFAAWKLQLLDRCTAGWLADGSARYPIVNPRARCGGRRPGVRSLGFPDATRRLFGVYCYRAPGAPDPAPGGWGWGWAGGGGWAGGARDPAAWTPLHV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
43.7 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Hyaluronan and Proteoglycan Link Protein 4 (HAPLN4) is produced in E. coli and spans the complete mature protein sequence from amino acids 30 to 402. The protein carries an N-terminal 10xHis-tag for easier purification and detection. SDS-PAGE analysis shows purity levels above 85%, which appears to provide reliable performance for research work.

HAPLN4 likely plays a crucial role in stabilizing how hyaluronic acid and proteoglycans interact within the extracellular matrix. It seems particularly important for maintaining the structural integrity of cartilage and neural tissues. Research into HAPLN4's molecular pathways may prove essential for understanding how tissues develop and repair themselves.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Human HAPLN4 is an extracellular matrix protein that requires complex disulfide bond formation and proper folding for its structural and functional roles in organizing proteoglycan-hyaluronan complexes. The E. coli expression system cannot perform the necessary post-translational modifications (particularly proper disulfide bonding) that are critical for this protein's native conformation. While the protein may be soluble, it is highly unlikely to achieve the correct three-dimensional structure needed for functional activity. The probability of correct folding is low, and biological activity cannot be assumed.

1. Antibody Development and Validation

This recombinant HAPLN4 serves as an excellent immunogen for generating antibodies against linear epitopes of the protein. The full-length mature sequence ensures comprehensive epitope coverage. However, antibodies produced against this bacterially expressed protein may not efficiently recognize conformational epitopes on the native, properly folded HAPLN4 found in tissues, as they will primarily target linear sequences.

2. ELISA-Based Quantitative Assays

This protein is well-suited as a standard for quantitative ELISA assays to measure immunoreactive HAPLN4 levels. The assay depends on antibody binding to linear epitopes, so the protein's folding state is less critical. The His-tag facilitates consistent immobilization for reliable standard curve generation.

Final Recommendation & Action Plan

The protein can be reliably used for Application 1 (Antibody Development) and Application 2 (as an ELISA standard). Extracellular matrix protein interactions are highly dependent on precise three-dimensional conformation. Functional extracellular matrix studies require properly folded, active proteins. This bacterially expressed variant cannot recapitulate native HAPLN4 function.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Binds to hyaluronic acid and may be involved in formation of the extracellular matrix.
Gene References into Functions
  1. Observational study and meta-analysis of gene-disease association. (HuGE Navigator) PMID: 20950796
  2. Results indicate that HAPLN4 and HAPLN2 are the predominant members of this family in the adult human brain but are strongly reduced in the tumor parenchyma. PMID: 19633295
Subcellular Location
Secreted, extracellular space, extracellular matrix.
Protein Families
HAPLN family
Tissue Specificity
Expressed predominantly in brain.
Database Links

HGNC: 31357

KEGG: hsa:404037

STRING: 9606.ENSP00000291481

UniGene: Hs.367829

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*