Recombinant Human Hyaluronan and proteoglycan link protein 4 (HAPLN4)

In Stock
Code CSB-EP010133HU
Abbreviation Recombinant Human HAPLN4 protein
MSDS
Size US$306
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
HAPLN4
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Brain link protein 2; BRAL 2; BRAL2; HAPLN 4; Hapln4; HPLN4_HUMAN; Hyaluronan and proteoglycan link protein 4; Hyaluronan and proteoglycan link protein 4 precursor ; KIAA1926
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
30-402aa
Target Protein Sequence
QRGRKKVVHVLEGESGSVVVQTAPGQVVSHRGGTIVLPCRYHYEAAAHGHDGVRLKWTKVVDPLAFTDVFVALGPQHRAFGSYRGRAELQGDGPGDASLVLRNVTLQDYGRYECEVTNELEDDAGMVKLDLEGVVFPYHPRGGRYKLTFAEAQRACAEQDGILASAEQLHAAWRDGLDWCNAGWLRDGSVQYPVNRPREPCGGLGGTGSAGGGGDANGGLRNYGYRHNAEERYDAFCFTSNLPGRVFFLKPLRPVPFSGAARACAARGAAVAKVGQLFAAWKLQLLDRCTAGWLADGSARYPIVNPRARCGGRRPGVRSLGFPDATRRLFGVYCYRAPGAPDPAPGGWGWGWAGGGGWAGGARDPAAWTPLHV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
43.7 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Hyaluronan and Proteoglycan Link Protein 4 (HAPLN4) is produced in E. coli and spans the complete mature protein sequence from amino acids 30 to 402. The protein carries an N-terminal 10xHis-tag for easier purification and detection. SDS-PAGE analysis shows purity levels above 85%, which appears to provide reliable performance for research work.

HAPLN4 likely plays a crucial role in stabilizing how hyaluronic acid and proteoglycans interact within the extracellular matrix. It seems particularly important for maintaining the structural integrity of cartilage and neural tissues. Research into HAPLN4's molecular pathways may prove essential for understanding how tissues develop and repair themselves.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Antibody Development and Validation

This recombinant HAPLN4 protein works well as an immunogen for creating both polyclonal and monoclonal antibodies that target human HAPLN4. The N-terminal 10xHis tag makes purification straightforward and allows for easy immobilization during antibody screening. Researchers can also use it as a positive control in Western blots, ELISAs, and immunofluorescence experiments to confirm antibody specificity. The 85%+ purity level should be sufficient for most immunization protocols and follow-up antibody characterization work.

2. Protein-Protein Interaction Studies

His-tagged HAPLN4 works particularly well in pull-down experiments designed to find new binding partners or verify known interactions with extracellular matrix components. The 10xHis tag allows researchers to attach the protein to nickel-based resins, making it possible to capture interacting proteins from cell lysates or purified protein solutions. This method may help clarify HAPLN4's actual role in organizing the extracellular matrix and reveal how it interacts within proteoglycan complexes. The recombinant protein can also serve as bait in co-immunoprecipitation studies when paired with suitable antibodies.

3. ELISA-Based Quantitative Assays

The purified HAPLN4 protein serves as either a standard or coating antigen in enzyme-linked immunosorbent assays for research purposes. The His tag enables consistent, oriented attachment to nickel-coated plates, which might improve both assay reliability and sensitivity. Researchers can use this protein to build sandwich ELISAs for measuring HAPLN4 concentrations in cell culture media or tissue samples. The known concentration and purity make it well-suited for creating standard curves in quantitative immunoassays.

4. Cell Culture Studies and Extracellular Matrix Research

Researchers can add this recombinant HAPLN4 directly to cell culture systems to examine how it affects cell behavior, adhesion, or movement patterns in vitro. The protein proves useful for studying extracellular matrix assembly by observing cellular responses to added HAPLN4 under controlled culture conditions. Scientists might explore its potential in tissue engineering applications or investigate its broader functions in extracellular matrix biology. Using recombinant protein creates more controlled experimental conditions compared to proteins extracted from tissues, which often show batch-to-batch variation.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Binds to hyaluronic acid and may be involved in formation of the extracellular matrix.
Gene References into Functions
  1. Observational study and meta-analysis of gene-disease association. (HuGE Navigator) PMID: 20950796
  2. Results indicate that HAPLN4 and HAPLN2 are the predominant members of this family in the adult human brain but are strongly reduced in the tumor parenchyma. PMID: 19633295
Subcellular Location
Secreted, extracellular space, extracellular matrix.
Protein Families
HAPLN family
Tissue Specificity
Expressed predominantly in brain.
Database Links

HGNC: 31357

KEGG: hsa:404037

STRING: 9606.ENSP00000291481

UniGene: Hs.367829

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*