Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
I18BP_HUMAN; IL-18BP; IL18 binding protein; IL18 BP; IL18 BPa; IL18BP; IL18BPa; Interleukin 18 binding protein; Interleukin-18-binding protein; MC51L 53L 54L homolog gene product; Tadekinig alfa; Tadekinig-alfa
Species
Homo sapiens (Human)
Expression Region
31-183aa
Target Protein Sequence
TPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEAL
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The recombinant Human IL18BP was expressed with the amino acid range of 31-183. The theoretical molecular weight of the IL18BP protein is 20.5 kDa. The IL18BP protein was expressed in e.coli. The IL18BP gene fragment has been modified by fusing the N-terminal 6xHis tag, providing convenience in detecting and purifying the recombinant IL18BP protein during the following stages.
The human interleukin-18-binding protein (IL18BP) is a soluble protein that plays a regulatory role in the immune system. IL18BP acts as a natural inhibitor of IL-18, a pro-inflammatory cytokine. IL18BP binds to IL-18 with high affinity, preventing its interaction with its cell surface receptor and inhibiting downstream signaling. By neutralizing IL-18, IL18BP helps regulate immune responses and control inflammation. Research on IL18BP focuses on its role in immune modulation and its potential therapeutic applications in conditions associated with dysregulated IL-18 signaling, such as inflammatory and autoimmune diseases.
