Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

IL18BP

Uniprot No.

O95998

Research Area

Immunology

Alternative Names

I18BP_HUMAN; IL-18BP; IL18 binding protein; IL18 BP; IL18 BPa; IL18BP; IL18BPa; Interleukin 18 binding protein; Interleukin-18-binding protein; MC51L 53L 54L homolog gene product; Tadekinig alfa; Tadekinig-alfa

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

31-183aa

Target Protein Sequence

TPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEAL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

20.5kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The recombinant Human IL18BP was expressed with the amino acid range of 31-183. The theoretical molecular weight of the IL18BP protein is 20.5 kDa. The IL18BP protein was expressed in e.coli. The IL18BP gene fragment has been modified by fusing the N-terminal 6xHis tag, providing convenience in detecting and purifying the recombinant IL18BP protein during the following stages.

The human interleukin-18-binding protein (IL18BP) is a soluble protein that plays a regulatory role in the immune system. IL18BP acts as a natural inhibitor of IL-18, a pro-inflammatory cytokine. IL18BP binds to IL-18 with high affinity, preventing its interaction with its cell surface receptor and inhibiting downstream signaling. By neutralizing IL-18, IL18BP helps regulate immune responses and control inflammation. Research on IL18BP focuses on its role in immune modulation and its potential therapeutic applications in conditions associated with dysregulated IL-18 signaling, such as inflammatory and autoimmune diseases.

Target Background

Function

Isoform A binds to IL-18 and inhibits its activity. Functions as an inhibitor of the early TH1 cytokine response.

Gene References into Functions

these results were corroborated in female osteoporotic subjects where decreased serum IL-18BP levels and enhanced serum IL-18 levels were observed. Our study forms a strong basis for using humanized IL-18BP towards the treatment of postmenopausal osteoporosis. PMID: 27649785
epigenetic silencing by single CpG methylation determines differential IL18BP inducibility in monocytic versus epithelial cells. T PMID: 29409936
a large proportion blood basophils from patients with asthma express IL-18 and IL-18BP. mast cells and basophils are implicated in the pathogenesis of asthma via an IL-18-related mechanism. PMID: 29505668
The maintenance of normal production of IL-18BP may contribute, at least in part, to the ability ofLong Term Non-Progressors to delay AIDS progression. PMID: 27863336
Platelets also contain the IL-18 antagonist, the IL-18-Binding Protein (IL-18BP); however, it is not synthesized in them de novo, is present in pre-made form and is released irrespective of platelet activation. PMID: 27914933
The serum levels of IL-37, which were correlated with antibody production and the serum levels of total IL-18 and IL-18BP, were elevated in the patients with primary Sjogren's syndrome. PMID: 28057714
an imbalance in the production of IL-18 and its antagonist (an increase in the production of IL-18 with a decrease, no increase or an insufficient increase in the production of IL-18BP) has been described in many chronic inflammatory diseases in humans. PMID: 26898120
IL-18, IL-18R and IL-18BP expression in eosinophil are involved in the inflammatory reaction of asthma. PMID: 28395725
the inhibition of IL-18 signaling by IL-18BPa may be involved in the development of pulmonary vascular involvement leading to pulmonary hypertension and modulate the systemic inflammation in systemic sclerosis PMID: 26777734
The natural IL-18 inhibitor IL-18BP further regulates IL-18 activity in the extracellular environment. Review. PMID: 25548255
imbalance of IL-18/IL-18BP ratio in IgA nephropathy especially in patients with arteriolar lesions PMID: 25807634
IL-18, IL-18BP, and IL-18R may have roles in the pathogenesis of epithelial ovarian carcinoma PMID: 24963217
HPV16 E7 oncoprotein increases production of the IL18BP in keratinocytes. PMID: 24478434
these data indicate that IL-18BP, which is produced in EOC in response to microenvironmental factors, may inhibit endogenous or exogenous IL-18 activity PMID: 23873689
Data suggest that the imbalance of IL-18/IL-18BP might play an important role in the pathogenesis of systemic juvenile idiopathic arthritis (SJIA) and it might go hand-in-hand with the severity of SJIA. PMID: 23419721
Due to highly significant increases in circulating IL-18BP in schizophrenia compared to controls, the levels of free IL-18 are not significantly different between schizophrenic groups. PMID: 22913567
Imbalance between IL-18 and IL-18BP may play an important role in pathogenesis of idiopathic thrombocytopenic purpura. PMID: 21867627
High IL-18 BP levels indicate the severity of existing glomerular injury in systemic lupus erythematosus. PMID: 21656327
The balance between interleukin-18 (IL-18) and its endogenous antagonist, IL-18 binding protein (IL-18BP), was evaluated in children with Henoch-Schonlein purpura. PMID: 22289535
IL-18/IL-18BP imbalance plays an important role in pathogenesis of primary immune thrombocytopenia. PMID: 21418867
In T2DM patients, 18 BP began to increase after IL-18 increased and reached a threshold, in which case kidney dysfunction would have developed. PMID: 21440322
increased levels of both IL-18 and its natural inhibitor IL-18BP, characterise SLE PMID: 21126942
In lines of intestinal epithelial cells from inflammatory bowel disease patients, interferon-gamma selectively up-regulated IL-18 binding protein. PMID: 21078084
lupus nephritis patients present lower IL-18BP mRNA expression and higher serum levels of IL-18 than those in normal controls PMID: 20140691
Altogether, data presented herein indicate that direct action of STAT1 on the IL-18BP promoter at the proximal GAS element is key to IL-18BP expression by IFN-gamma-stimulated DLD-1 colon carcinoma cells PMID: 19046253
High circulating levels in patients with active Systemic Lupus Erythematosus PMID: 19699611
Endometrial interleukin-18 binding protein mRNA expression may possibly be responsible for the pathologic process of adenomyosis. PMID: 19394601
Suggest that an early rise in IL-18 levels may play a role in reverse remodeling process following aortic valve replacement. PMID: 19961286
Since IL-18 plays a major role in perpetuating hemophagocytosis, the failure of IFNgamma to induce IL-18BP may constitute a fundamental pathogenetic mechanism PMID: 20072626
trancriptional activation and release of IL-18 binding protein in response to IFN-gamma PMID: 11739524
IL-18BP messenger transcript and protein are significantly increased in surgically resected specimens from active Crohn's disease compared with control patients, correlating with an up-regulation of IL-18. PMID: 11907126
after binding to IL-18BP, IL-1F7b forms a complex with IL-18Rbeta, depriving the beta-chain of forming a functional receptor complex with IL-18Ralpha and thus inhibiting IL-18 activity PMID: 12381835
IRF-1-CEBPbeta complex activate the promoter of IL-18 binding protein. PMID: 12482935
Administration of recombinant human IL-18BP not only reduces symptoms of murine contact hypersensitivity (CHS) during the elicitation phase but also significantly decreases inflammation in mice that had previously undergone CHS without treatment. PMID: 12874202
High endogenous levels of IL-18BP in trangenic mice effectively neutralize IL-18 and are protective in response to different inflammatory stimuli. PMID: 12960225
production of IL-18BP in response to IL-12 and IL-18 was regulated differently in blood and synovial cells. PMID: 15188356
IL-18 levels, which are determined in part by variation in IL18/IL18BP, play a role in coronary heart disease development and postsurgery outcome. PMID: 17951325
Despite the elevated IL-18BP levels during active disease, free IL-18 remained higher than in the inactive disease stages, suggesting a potential benefit of administration of exogenous IL-18BP as a therapeutic approach for active Wegener's granulomatosis. PMID: 18594952

Hide All

Subcellular Location

Secreted.

Tissue Specificity

Strongly expressed in heart, lung, placenta and spleen.

Database Links

HGNC: 5987

OMIM: 604113

KEGG: hsa:10068

STRING: 9606.ENSP00000260049

UniGene: Hs.591967

Code	CSB-EP011609HU1
Abbreviation	Recombinant Human IL18BP protein, partial
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-RP167394h could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) IL18BP. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-RP167394h could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) IL18BP.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Interleukin-18-binding protein (IL18BP), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage