Recombinant Human Kielin/chordin-like protein (KCP), partial

Code CSB-EP012103HU
Abbreviation Recombinant Human KCP protein, partial
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
KCP
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Cysteine-rich BMP regulator 2 Cysteine-rich motor neuron 2 protein Kielin/chordin-like protein 1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1084-1478aa
Target Protein Sequence
QSCVHQGREVASGERWTVDTCTSCSCMAGTVRCQSQRCSPLSCGPDKAPALSPGSCCPRCLPRPASCMAFGDPHYRTFDGRLLHFQGSCSYVLAKDCHSGDFSVHVTNDDRGRSGVAWTQEVAVLLGDMAVRLLQDGAVTVDGHPVALPFLQEPLLYVELRGHTVILHAQPGLQVLWDGQSQVEVSVPGSYQGRTCGLCGNFNGFAQDDLQGPEGLLLPSEAAFGNSWQVSEGLWPGRPCSAGREVDPCRAAGYRARREANARCGVLKSSPFSRCHAVVPPEPFFAACVYDLCACGPGSSADACLCDALEAYASHCRQAGVTPTWRGPTLCVVGCPLERGFVFDECGPPCPRTCFNQHIPLGELAAHCVRPCVPGCQCPAGLVEHEAHCIPPEAC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
49.5 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
13-23 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Kielin/chordin-like protein (KCP) is a secretory protein with 18 cysteine-rich domains [1]. It has been identified as an enhancer of BMP-7 signaling, and it enhances BMP signaling by facilitating the binding of BMP7 to BMP receptor 1A [2][3]. KCP enhances BMP signaling by stabilizing BMP ligand-receptor interactions [4]. Additionally, KCP enhances BMP-7 activity by increasing BMP-7 binding to its receptor [5]. KCP stimulates BMP-7 signaling, and KCP-deficient mice have been found to be susceptible to developing renal interstitial fibrosis [6]. Furthermore, KCP enhances BMP/receptor interactions to increase the efficacy of signaling [7][8]. It has been suggested that KCP enhances the binding of the Bmp protein and its receptor by forming a tertiary complex [9]. KCP is similar in structure and function to a group of human complement inhibitors belonging to the family of regulators of complement activation (RCA) [10].

References:
[1] Y. Xu, "Kielin/chordin‐like protein deficiency aggravates pressure overload‐induced cardiac dysfunction and remodeling via p53/p21/ccnb1 signaling in mice", The Faseb Journal, vol. 38, no. 5, 2024. https://doi.org/10.1096/fj.202301841r
[2] R. Weiskirchen, "Bmp-7 as antagonist of organ fibrosis", Frontiers in Bioscience-Scholar, vol. 14, no. 1, p. 4992, 2009. https://doi.org/10.2741/3583
[3] A. Soofi, P. Zhang, & G. Dressler, "Kielin/chordin-like protein attenuates both acute and chronic renal injury", Journal of the American Society of Nephrology, vol. 24, no. 6, p. 897-905, 2013. https://doi.org/10.1681/asn.2012070759
[4] S. Bradford, E. Ranghini, E. Grimley, P. Lee, & G. Dressler, "High-throughput screens for agonists of bone morphogenetic protein (bmp) signaling identify potent benzoxazole compounds", Journal of Biological Chemistry, vol. 294, no. 9, p. 3125-3136, 2019. https://doi.org/10.1074/jbc.ra118.006817
[5] M. Zeisberg and R. Kalluri, "Reversal of experimental renal fibrosis by bmp7 provides insights into novel therapeutic strategies for chronic kidney disease", Pediatric Nephrology, vol. 23, no. 9, p. 1395-1398, 2008. https://doi.org/10.1007/s00467-008-0818-x
[6] A. Khwaja, M. Kossi, J. Floege, & M. Nahas, "The management of ckd: a look into the future", Kidney International, vol. 72, no. 11, p. 1316-1323, 2007. https://doi.org/10.1038/sj.ki.5002489
[7] J. Lin, S. Patel, M. Wang, & G. Dressler, "The cysteine-rich domain protein kcp is a suppressor of transforming growth factor β/activin signaling in renal epithelia", Molecular and Cellular Biology, vol. 26, no. 12, p. 4577-4585, 2006. https://doi.org/10.1128/mcb.02127-05
[8] A. Soofi, K. Wolf, M. Emont, N. Qi, G. Martinez-Santibañez, E. Grimleyet al., "The kielin/chordin-like protein (kcp) attenuates high-fat diet-induced obesity and metabolic syndrome in mice", Journal of Biological Chemistry, vol. 292, no. 22, p. 9051-9062, 2017. https://doi.org/10.1074/jbc.m116.771428
[9] M. Ikeya, M. Kawada, H. Kanazawa, N. Sasai, K. Nakao, Y. Furutaet al., "Essential pro-bmp roles of crossveinless 2 in mouse organogenesis", Development, vol. 133, no. 22, p. 4463-4473, 2006. https://doi.org/10.1242/dev.02647
[10] L. Mark, O. Spiller, M. Okroj, S. Chanas, J. Aitken, S. Wonget al., "Molecular characterization of the rhesus rhadinovirus (rrv) orf4 gene and the rrv complement control protein it encodes", Journal of Virology, vol. 81, no. 8, p. 4166-4176, 2007. https://doi.org/10.1128/jvi.02069-06

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Enhances bone morphogenetic protein (BMP) signaling in a paracrine manner. In contrast, it inhibits both the activin-A and TGFB1-mediated signaling pathways.
Subcellular Location
Secreted.
Database Links

HGNC: 17585

OMIM: 609344

UniGene: Hs.371746

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*