Recombinant Human Kininogen-1(KNG1),partial

Code CSB-RP146474h
Size US$1726
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names KNG1
Uniprot No. P01042
Research Area Cardiovascular
Alternative Names Alpha-2-thiol proteinase inhibitor; BDK; BK; Bradykinin; Bradykinin included; Fitzgerald factor; FLAUJEAC FACTOR; High molecular weight kininogen; HMWK; Ile-Ser-Bradykinin; Kallidin I; Kallidin II; KNG; KNG1; KNG1_HUMAN; Low molecular weight growth-promoting factor; WILLIAMS FACTOR; Williams-Fitzgerald-Flaujeac factor
Species Homo sapiens (Human)
Source E.coli
Expression Region 390-639aa
Target Protein Sequence SSRIGEIKEETTVSPPHTSMAPAQDEERDSGKEQGHTRRHDWGHEKQRKHNLGHGHKHERDQGHGHQRGHGLGHGHEQQHGLGHGHKFKLDDDLEHQGGHVLDHGHKHKHGHGHGKHKNKGKKNGKHNGWKTEHLASSSEDSTTPSAQTQEKTEGPTPIPSLAKPGVTVTFSDFQDSDLIATMMPPISPAPIQSDDDWIPDIQIDPNGLSFNPISDFPDTTSPKCPGRPWKSVSEINPTTQMKESYYFDL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 31.8 kDa
Protein Length Partial
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function (1) Kininogens are inhibitors of thiol proteases; (2) HMW-kininogen plays an important role in blood coagulation by helping to position optimally prekallikrein and factor XI next to factor XII; (3) HMW-kininogen inhibits the thrombin- and plasmin-induced aggregation of thrombocytes; (4) the active peptide bradykinin that is released from HMW-kininogen shows a variety of physiological effects
Gene References into Functions
  1. Kininogen binds to the cell surface-exposed proteins of Candida parapsilosis. PMID: 28651026
  2. Three loci showed robust, replicating association with circulating FXI levels: KNG1 (rs710446, P-value = 2.07 x 10-302), F11 (rs4253417, P-value = 2.86 x 10-193), and a novel association in GCKR (rs780094, P-value = 3.56 x10-09), here for the first time implicated in FXI regulation. The two first SNPs (rs710446 and rs4253417) also associated with partial thromboplastin time PMID: 28053049
  3. findings show that the KNG1 locus plays a central role as a genetic determinant of the entire coagulation pathway and thrombus/clot formation PMID: 28005926
  4. Urinary KNG1 and RBP4 clearly respond to AKI. Additionally, RBP4 could predict recovery by monitoring this protein levels over time after AKI, as RBP4 reflects patient's normalization earlier than sCr values do. PMID: 26792617
  5. KNG1 rs710446/ rs2304456 SNPs are not related to the incidence of Alzheimer's disease in a Hunan Han Chinese population. PMID: 26884824
  6. Low urine KNG1 expression is associated with clear cell renal cell carcinoma. PMID: 26420021
  7. The results of this study supported the association of the epistatic interactions of ALOX5AP, THBD, and KNG1 and present novel evidence for the main effect of KNG1 gene on IS susceptibility. PMID: 26159646
  8. Bradykinin stimulates pro-contractile signalling mechanisms in human myometrial cells and arrestin proteins play key roles in their regulation. PMID: 25766502
  9. Measuring plasma levels of cleaved HK may be a sensitive mean of assessing disease severity in HAE-C1-INH patients. PMID: 24552232
  10. The antimicrobial protein kininogen evolved adaptively in mammals and human populations. PMID: 23505046
  11. results demonstrate that HKa accelerates the onset of EPC senescence by stimulating JNK/FOXO4/MnSOD pathway, its effect is mediated by the HC PMID: 24984152
  12. When the concentrations of IGFBP-6 or KNG1 were greater than 98.5 pg/ml or 88.5 ng/ml, respectively, they predicted the proliferative vitreoretinopathy prognosis. PMID: 23808406
  13. uPAR mediates efferocytosis through high molecular weight kininogen interaction with phosphatidylserine on apoptotic cells PMID: 24688027
  14. these results suggest that D5(H) of high molecular weight kininogen may modulate cell adhesion and invasion together with actinin-4. PMID: 23000411
  15. KNG1 and F11 are the main genetic regulators of plasma FXI level. PMID: 22701019
  16. The results showed that bradykinin stimulates Toll-like receptor 2 transcription and translation by activation of protein kinase C as well as proto-oncogene protein AKT. PMID: 21982724
  17. kininogen-1 and thymosin-beta(4) are potential new biomarkers for human chronic hepatitis C. PMID: 21496200
  18. Bacteroides fragilis and Bacteroides thetaiotaomicron, were found to bind HK and fibrinogen PMID: 21527472
  19. High molecular weight kininogen activates B2 receptor signaling pathway in human vascular endothelial cells. PMID: 21586566
  20. Kininogen-1 and IGFBP-6 are expressed in serum and vitreous humor in proliferative vitreoretinopathy patients. PMID: 21054968
  21. Bradykinin, acting via bradykinin 2 receptors, initiates an important signal directing the invasion of glioma patients' cells toward blood vessels. PMID: 21451024
  22. KNG1 Ile581Thr and susceptibility to venous thrombosis. PMID: 21270443
  23. expression of ACE is lowest in elderly women, despite the presence of similar BK degradation in pericardial fluid PMID: 19592120
  24. These findings provide the first genome-wide significant evidence of association with plasma adiponectin at the CDH13 locus and identify a novel uncommon KNG1-ADIPOQ haplotype strongly associated with adiponectin levels in Filipinos. PMID: 20876611
  25. KNG1 SNP rs710448 (allele frequency 42%) was associated with decreased risk (OR 0.44, 95% CI 0.3-0.8) among women but not men. PMID: 19716087
  26. High-glucose stimulates tubular proinflammatory, profibrotic and angiogenic signals, which is partly mediated through bradykinin via MAPK signalling and partly through protein kinase C independent of bradykinin. PMID: 19923143
  27. Single Nucleotide Polymorphisms in KNG1 is associated with activated partial thromboplastin time. PMID: 20303064
  28. our findings suggest that bradykinin and bradykinin B2 receptors are involved in the modulation of mechanisms participating in inflammatory synovitis PMID: 20050188
  29. Bradykinin enhances the migration of chondrosarcoma cells by increasing alpha2beta1 integrin expression through the BK receptors/PLC/PKCdelta/NF-kappaB signal transduction pathway. PMID: 19885862
  30. High molecular weight kininogen (HKa) mimics lipopolysaccharides by triggering a paracrine pathway in monocytes that depends on TNF-alpha and IL-1beta. Upregulation of tissue factor in monocytes by cleaved HKa is dependent on TNF-alpha and IL-1beta. PMID: 19966052
  31. inhibition of vitronectin-mediated haptotaxis and haptoinvasion of MG-63 cells by domain 5 PMID: 11689005
  32. Heat shock protein 90 catalyzes activation of the prekallikrein-kininogen complex in the absence of factor XII. PMID: 11792853
  33. down-regulates cathepsin G-induced platelet activation by forming a complex with cathepsin G and thus prevents binding of cathepsin G to platelets PMID: 11920276
  34. a defined region can abolish platelet adhesion to vitronectin and block platelet aggregation PMID: 11970955
  35. Ferritin binds to light chain of human H-kininogen and inhibits kallikrein-mediated bradykinin release. PMID: 12071855
  36. kininogen has as role as a antithrombotic agent by inhibiting plasminogen activator inhibitor-1 PMID: 12082110
  37. Bradykinin induces IL-6 production in human airway smooth muscle cells. PMID: 12594059
  38. free HK, or HK in complex with prekallikrein but not in complex with factor XI, interacts with the endothelium and can maintain endothelial cell quiescence by preventing endothelial stimulation by thrombin. PMID: 12663668
  39. transcriptional activation of the interleukin-8 promoter by bradykinin involves the prostanoid-independent activation of nuclear factor-kappaB, and prostanoid-dependent activation of activating protein-1 and nuclear factor-interleukin-6 PMID: 12748173
  40. kininogen is a novel and direct target of farnesoid X receptor PMID: 12761213
  41. Bradykinin is a powerful spasmogen via B(2) receptor activation in the normal and, especially, in the inflamed human gallbladder. PMID: 12851878
  42. sequences in domain 5 of high molecular weight kininogen interact with heparin and zinc PMID: 12911595
  43. High molecular weight kininogen regulates platelet-leukocyte interactions by bridging Mac-1 and glycoprotein Ib PMID: 12952972
  44. His-Gly-Lys motif and lysine residue (Lys487) play essential roles in inhibition of cell adhesion and invasion in vitro and in prevention of metastasis of cancer cells in vivo PMID: 14506238
  45. COX-2 induction by bradykinin in human pulmonary artery smooth muscle cells is mediated by the cyclic AMP response element through a novel autocrine loop involving endogenous prostaglandin E2, EP2 receptor, and EP4 receptor PMID: 14517215
  46. binds with high specificity and affinity to microvascular endothelial cells, but with lower affinity to astrocytes; cytokeratin 1, u-PAR,and gC1qR were found to be high molecular weight kininogen binding proteins present at the surface of these cells PMID: 14597972
  47. The rate of kallikrein formation by the assembly of factor XII, high molecular weight KNG and PK were similar in both heparinase-treated and non-treated HUVEC, indicating that heparan sulfate does not contribute significantly to HK binding to HUVEC. PMID: 14629481
  48. physically disrupts the formation of a signaling complex containing uPAR, integrin alpha(v)beta3 or alpha5beta1, caveolin, and Src kinase Yes in endothelial cells in a manner that parallels its apoptotic effect PMID: 15044324
  49. ACE-I-induced renoprotection, in the context of macrophage-stimulated mesangial cell scarring, is mediated, at least in part, via the actions of bradykinin. PMID: 15086463
  50. high molecular weight kininogen has an antibacterial domain, called domain 5 PMID: 16091369
  51. like filarial cystatins, T-KG inhibits ERK-dependent T cell proliferation, which suggests that it might have a role in immunosenescence PMID: 16140359
  52. KNG modulate bone marrow derived stromal/preosteoblast cell proliferation and suppress etoposide-induced apoptosis through ERK and HSP27 activation, respectively. These results implicate a pathophysiologic role for KNG in patients with PD. PMID: 16598774
  53. kininogen levels were found to be significantly lower in chorion laeve, placental plate chorion, fetal placenta and maternal placenta from women with Pregnancy Induced Hypertension when compared to those in similar tissues from normotensive pregnant women PMID: 17050061
  54. The D5 active site of high molecular weight kininogen binds to endothelial cells and downregulates alpha(v)beta3 integrin bidirectional signaling and the downstream Rac1 activation pathway PMID: 17585065
  55. Review highlights the release of bradykinin as a damage-associated endogenous signal that activates dendritic cells during inflammation. PMID: 17635790
  56. interaction between LPS and high molecular weight kininogen (HK) PMID: 18083112
  57. studies suggest that IL-1beta, BK, and TGF-beta1 impair IP receptor-mediated cAMP accumulation by multiple effects on different components of the signaling pathway and that these effects are PKA and p38 MAP kinase dependent. PMID: 18156442
  58. 47kD HK levels, an indicator of bradykinin release, correlated with sepsis severity. PMID: 18330734
  59. patients with IC with decreased THP and kininogen had worsening IC severity.Uromodulin and kininogen were significantly less present in the urine of the IC group vs the AC group. PMID: 18455532
  60. a possible explanation for the potency of bradykinin in inducing ongoing airway inflammation PMID: 18783336
  61. The authors show that bradykinin and the B(2)R play a role in early innate immune functions during listeria infection. PMID: 18810490
  62. ferritin binds to HKa (cleaved high molecular weight kininogen) with high affinity (K(d) 13 nM). Further, ferritin antagonizes the antiangiogenic effects of HKa, enhancing the migration, assembly, and survival of HKa-treated endothelial cells PMID: 19126685
  63. Bradykinin-induced dilation of human coronary arterioles requires NADPH oxidase-derived reactive oxygen species PMID: 19213944
  64. Both single-locus and haplotype analyses indicated that the KNG1 gene was associated with essential hypertension and blood pressure traits in the Chinese male population. PMID: 19330902
  65. the inhibitory role of HK domain 5 on platelet adhesion and aggregation; new anti-thrombotic compounds may become available on the basis of peptide Gly-486-Lys-502 of HK domain 5. PMID: 11970955

Show More

Hide All

Involvement in disease High molecular weight kininogen deficiency (HMWK deficiency)
Subcellular Location Secreted, extracellular space
Tissue Specificity Secreted in plasma. T-kinin is detected in malignant ovarian, colon and breast carcinomas, but not in benign tumors.
Database Links

HGNC: 6383

OMIM: 228960

KEGG: hsa:3827

STRING: 9606.ENSP00000265023

UniGene: Hs.77741

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1