Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

KNG1

Uniprot No.

P01042

Research Area

Cardiovascular

Alternative Names

Alpha-2-thiol proteinase inhibitor; BDK; BK; Bradykinin; Bradykinin included; Fitzgerald factor; FLAUJEAC FACTOR; High molecular weight kininogen; HMWK; Ile-Ser-Bradykinin; Kallidin I; Kallidin II; KNG; KNG1; KNG1_HUMAN; Low molecular weight growth-promoting factor; WILLIAMS FACTOR; Williams-Fitzgerald-Flaujeac factor

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

390-639aa

Target Protein Sequence

SSRIGEIKEETTVSPPHTSMAPAQDEERDSGKEQGHTRRHDWGHEKQRKHNLGHGHKHERDQGHGHQRGHGLGHGHEQQHGLGHGHKFKLDDDLEHQGGHVLDHGHKHKHGHGHGKHKNKGKKNGKHNGWKTEHLASSSEDSTTPSAQTQEKTEGPTPIPSLAKPGVTVTFSDFQDSDLIATMMPPISPAPIQSDDDWIPDIQIDPNGLSFNPISDFPDTTSPKCPGRPWKSVSEINPTTQMKESYYFDL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

31.8 kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

In e.coli cells, the generation of recombinant Human KNG1 protein involves cloning a DNA fragment encoding the Human KNG1 protein (390-639aa) into a plasmid vector, which is then transferred into the e.coli cells. Positive cells are selected, cultured, and induced to express the KNG1 protein. A N-terminal 6xHis tag is attached to the protein. Lysis of the cells allows for the harvest of the recombinant Human KNG1 protein. The collected recombiant Human KNG1 protein is subjected to affinity purification and is identified using SDS-PAGE and subsequent staining of the gel with Coomassie Brilliant Blue. Its purity is greater than 90%.

Target Background

Function

(1) Kininogens are inhibitors of thiol proteases; (2) HMW-kininogen plays an important role in blood coagulation by helping to position optimally prekallikrein and factor XI next to factor XII; (3) HMW-kininogen inhibits the thrombin- and plasmin-induced aggregation of thrombocytes; (4) the active peptide bradykinin that is released from HMW-kininogen shows a variety of physiological effects: (4A) influence in smooth muscle contraction, (4B) induction of hypotension, (4C) natriuresis and diuresis, (4D) decrease in blood glucose level, (4E) it is a mediator of inflammation and causes (4E1) increase in vascular permeability, (4E2) stimulation of nociceptors (4E3) release of other mediators of inflammation (e.g. prostaglandins), (4F) it has a cardioprotective effect (directly via bradykinin action, indirectly via endothelium-derived relaxing factor action); (5) LMW-kininogen inhibits the aggregation of thrombocytes; (6) LMW-kininogen is in contrast to HMW-kininogen not involved in blood clotting.

Gene References into Functions

Kininogen binds to the cell surface-exposed proteins of Candida parapsilosis. PMID: 28651026
Three loci showed robust, replicating association with circulating FXI levels: KNG1 (rs710446, P-value = 2.07 x 10-302), F11 (rs4253417, P-value = 2.86 x 10-193), and a novel association in GCKR (rs780094, P-value = 3.56 x10-09), here for the first time implicated in FXI regulation. The two first SNPs (rs710446 and rs4253417) also associated with partial thromboplastin time PMID: 28053049
findings show that the KNG1 locus plays a central role as a genetic determinant of the entire coagulation pathway and thrombus/clot formation PMID: 28005926
Urinary KNG1 and RBP4 clearly respond to AKI. Additionally, RBP4 could predict recovery by monitoring this protein levels over time after AKI, as RBP4 reflects patient's normalization earlier than sCr values do. PMID: 26792617
KNG1 rs710446/ rs2304456 SNPs are not related to the incidence of Alzheimer's disease in a Hunan Han Chinese population. PMID: 26884824
Low urine KNG1 expression is associated with clear cell renal cell carcinoma. PMID: 26420021
The results of this study supported the association of the epistatic interactions of ALOX5AP, THBD, and KNG1 and present novel evidence for the main effect of KNG1 gene on IS susceptibility. PMID: 26159646
Bradykinin stimulates pro-contractile signalling mechanisms in human myometrial cells and arrestin proteins play key roles in their regulation. PMID: 25766502
Measuring plasma levels of cleaved HK may be a sensitive mean of assessing disease severity in HAE-C1-INH patients. PMID: 24552232
The antimicrobial protein kininogen evolved adaptively in mammals and human populations. PMID: 23505046
results demonstrate that HKa accelerates the onset of EPC senescence by stimulating JNK/FOXO4/MnSOD pathway, its effect is mediated by the HC PMID: 24984152
When the concentrations of IGFBP-6 or KNG1 were greater than 98.5 pg/ml or 88.5 ng/ml, respectively, they predicted the proliferative vitreoretinopathy prognosis. PMID: 23808406
uPAR mediates efferocytosis through high molecular weight kininogen interaction with phosphatidylserine on apoptotic cells PMID: 24688027
these results suggest that D5(H) of high molecular weight kininogen may modulate cell adhesion and invasion together with actinin-4. PMID: 23000411
KNG1 and F11 are the main genetic regulators of plasma FXI level. PMID: 22701019
The results showed that bradykinin stimulates Toll-like receptor 2 transcription and translation by activation of protein kinase C as well as proto-oncogene protein AKT. PMID: 21982724
kininogen-1 and thymosin-beta(4) are potential new biomarkers for human chronic hepatitis C. PMID: 21496200
Bacteroides fragilis and Bacteroides thetaiotaomicron, were found to bind HK and fibrinogen PMID: 21527472
High molecular weight kininogen activates B2 receptor signaling pathway in human vascular endothelial cells. PMID: 21586566
Kininogen-1 and IGFBP-6 are expressed in serum and vitreous humor in proliferative vitreoretinopathy patients. PMID: 21054968
Bradykinin, acting via bradykinin 2 receptors, initiates an important signal directing the invasion of glioma patients' cells toward blood vessels. PMID: 21451024
KNG1 Ile581Thr and susceptibility to venous thrombosis. PMID: 21270443
expression of ACE is lowest in elderly women, despite the presence of similar BK degradation in pericardial fluid PMID: 19592120
These findings provide the first genome-wide significant evidence of association with plasma adiponectin at the CDH13 locus and identify a novel uncommon KNG1-ADIPOQ haplotype strongly associated with adiponectin levels in Filipinos. PMID: 20876611
KNG1 SNP rs710448 (allele frequency 42%) was associated with decreased risk (OR 0.44, 95% CI 0.3-0.8) among women but not men. PMID: 19716087
High-glucose stimulates tubular proinflammatory, profibrotic and angiogenic signals, which is partly mediated through bradykinin via MAPK signalling and partly through protein kinase C independent of bradykinin. PMID: 19923143
Single Nucleotide Polymorphisms in KNG1 is associated with activated partial thromboplastin time. PMID: 20303064
our findings suggest that bradykinin and bradykinin B2 receptors are involved in the modulation of mechanisms participating in inflammatory synovitis PMID: 20050188
Bradykinin enhances the migration of chondrosarcoma cells by increasing alpha2beta1 integrin expression through the BK receptors/PLC/PKCdelta/NF-kappaB signal transduction pathway. PMID: 19885862
High molecular weight kininogen (HKa) mimics lipopolysaccharides by triggering a paracrine pathway in monocytes that depends on TNF-alpha and IL-1beta. Upregulation of tissue factor in monocytes by cleaved HKa is dependent on TNF-alpha and IL-1beta. PMID: 19966052
inhibition of vitronectin-mediated haptotaxis and haptoinvasion of MG-63 cells by domain 5 PMID: 11689005
Heat shock protein 90 catalyzes activation of the prekallikrein-kininogen complex in the absence of factor XII. PMID: 11792853
down-regulates cathepsin G-induced platelet activation by forming a complex with cathepsin G and thus prevents binding of cathepsin G to platelets PMID: 11920276
a defined region can abolish platelet adhesion to vitronectin and block platelet aggregation PMID: 11970955
Ferritin binds to light chain of human H-kininogen and inhibits kallikrein-mediated bradykinin release. PMID: 12071855
kininogen has as role as a antithrombotic agent by inhibiting plasminogen activator inhibitor-1 PMID: 12082110
Bradykinin induces IL-6 production in human airway smooth muscle cells. PMID: 12594059
free HK, or HK in complex with prekallikrein but not in complex with factor XI, interacts with the endothelium and can maintain endothelial cell quiescence by preventing endothelial stimulation by thrombin. PMID: 12663668
transcriptional activation of the interleukin-8 promoter by bradykinin involves the prostanoid-independent activation of nuclear factor-kappaB, and prostanoid-dependent activation of activating protein-1 and nuclear factor-interleukin-6 PMID: 12748173
kininogen is a novel and direct target of farnesoid X receptor PMID: 12761213
Bradykinin is a powerful spasmogen via B(2) receptor activation in the normal and, especially, in the inflamed human gallbladder. PMID: 12851878
sequences in domain 5 of high molecular weight kininogen interact with heparin and zinc PMID: 12911595
High molecular weight kininogen regulates platelet-leukocyte interactions by bridging Mac-1 and glycoprotein Ib PMID: 12952972
His-Gly-Lys motif and lysine residue (Lys487) play essential roles in inhibition of cell adhesion and invasion in vitro and in prevention of metastasis of cancer cells in vivo PMID: 14506238
COX-2 induction by bradykinin in human pulmonary artery smooth muscle cells is mediated by the cyclic AMP response element through a novel autocrine loop involving endogenous prostaglandin E2, EP2 receptor, and EP4 receptor PMID: 14517215
binds with high specificity and affinity to microvascular endothelial cells, but with lower affinity to astrocytes; cytokeratin 1, u-PAR,and gC1qR were found to be high molecular weight kininogen binding proteins present at the surface of these cells PMID: 14597972
The rate of kallikrein formation by the assembly of factor XII, high molecular weight KNG and PK were similar in both heparinase-treated and non-treated HUVEC, indicating that heparan sulfate does not contribute significantly to HK binding to HUVEC. PMID: 14629481
physically disrupts the formation of a signaling complex containing uPAR, integrin alpha(v)beta3 or alpha5beta1, caveolin, and Src kinase Yes in endothelial cells in a manner that parallels its apoptotic effect PMID: 15044324
ACE-I-induced renoprotection, in the context of macrophage-stimulated mesangial cell scarring, is mediated, at least in part, via the actions of bradykinin. PMID: 15086463
high molecular weight kininogen has an antibacterial domain, called domain 5 PMID: 16091369

Hide All

Involvement in disease

High molecular weight kininogen deficiency (HMWK deficiency)

Subcellular Location

Secreted, extracellular space.

Tissue Specificity

Secreted in plasma. T-kinin is detected in malignant ovarian, colon and breast carcinomas, but not in benign tumors.

Database Links

HGNC: 6383

OMIM: 228960

KEGG: hsa:3827

STRING: 9606.ENSP00000265023

UniGene: Hs.77741

Code	CSB-EP012479HU
Abbreviation	Recombinant Human KNG1 protein, partial
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Kininogen-1 (KNG1), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage