Recombinant Human L-lactate dehydrogenase A chain(LDHA),partial

In Stock
Code CSB-EP012832HU1e1
Product Type Recombinant Protein
Size US$1892Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P00338
Lead Time 3-7 business days
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence KDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTL
Research Area Metabolism
Source E.coli
Gene Names LDHA
Protein Names Cell proliferation-inducing gene 19 proteinLDH muscle subunit
Expression Region 5-323aa
Tag Info Tag-Free
Mol. Weight 35.1 kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Involvement in disease Glycogen storage disease 11 (GSD11)
Subcellular Location Cytoplasm
Protein Families LDH/MDH superfamily, LDH family
Database Links

HGNC: 6535

OMIM: 150000

KEGG: hsa:3939

STRING: 9606.ENSP00000445175

UniGene: Hs.2795

Pathway HIF-1 signaling pathway
Glucagon signaling pathway

Related Products

LDHA Antibodies

LDHA Antibodies for Homo sapiens (Human)

LDHA Antibodies for Human

LDHA Proteins

LDHA Proteins for Homo sapiens (Human)

LDHA ELISA Kit

LDHA ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.