Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-EP012832HU1e1 |
| Product Type | Recombinant Protein |
| Size |
US$1892Purchase it in Cusabio online store (Shop online in the US. Customers outside the US, please order from local distributors.) |
| Uniprot No. | P00338 |
| Lead Time | 3-7 business days |
| Image |
|
| Storage Buffer | Tris-based buffer，50% glycerol |
| Species | Homo sapiens (Human) |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Sequence | KDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTL |
| Research Area | Metabolism |
| Source | E.coli |
| Gene Names | LDHA |
| Protein Names | Cell proliferation-inducing gene 19 proteinLDH muscle subunit |
| Expression Region | 5-323aa |
| Tag Info | Tag-Free |
| Mol. Weight | 35.1 kDa |
| Protein Description | Partial |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Involvement in disease | Glycogen storage disease 11 (GSD11) |
| Subcellular Location | Cytoplasm |
| Protein Families | LDH/MDH superfamily, LDH family |
| Database Links |
HGNC: 6535 OMIM: 150000 KEGG: hsa:3939 STRING: 9606.ENSP00000445175 UniGene: Hs.2795 |
| Pathway |
HIF-1 signaling pathway
Glucagon signaling pathway |
LDHA Antibodies for Homo sapiens (Human)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA012832GA01HU | LDHA Antibody | Human,Mouse,Rat | ELISA,WB |
| CSB-PA00045C0Rb | LDHA Antibody, FITC conjugated | Human | ELISA |
| CSB-PA00045D0Rb | LDHA Antibody, Biotin conjugated | Human | ELISA |
| CSB-PA00045B0Rb | LDHA Antibody, HRP conjugated | Human | ELISA |
LDHA Antibodies for Human
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA00045A0Rb | LDHA Antibody | Human | ELISA, WB, IHC, IF |
LDHA Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP012832HU CSB-EP012832HU CSB-BP012832HU CSB-MP012832HU |
Recombinant Human L-lactate dehydrogenase A chain(LDHA) | Yeast E.coli Baculovirus Mammalian cell |
| CSB-EP012832HU1 | Recombinant Human L-lactate dehydrogenase A chain(LDHA),partial | E.coli |
LDHA ELISA Kit for Homo sapiens (Human)
| Code | Product Name | Sample Types | Sensitivity |
|---|---|---|---|
| CSB-E17850h | Human lactate dehydrogenase A (LDHA) ELISA kit | serum, plasma, tissue homogenates, cell lysates | 7.81 mU/Ml |
Recombinant Human Oxytocin-neurophysin 1(OXT),partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Rat Dipeptidyl peptidase 4(Dpp4),partial
Express system: E.coli
Species: Rattus norvegicus (Rat)
Recombinant Human Tryptophan--tRNA ligase, cytoplasmic(WARS)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human T-lymphocyte activation antigen CD80(CD80)
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
