Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

LDHA

Uniprot No.

P00338

Research Area

Metabolism

Alternative Names

Cell proliferation-inducing gene 19 protein; GSD11; L lactate dehydrogenase B chain; L-lactate dehydrogenase A chain; Lactate dehydrogenase A; Lactate dehydrogenase B; Lactate dehydrogenase c variant 1; Lactate dehydrogenase c variant 3; Lactate dehydrogenase c variant 4; Lactate dehydrogenase C4; Lactate dehydrogenase H chain; Lactate dehydrogenase M; LDH A; LDH B; LDH H; LDH heart subunit; LDH M; LDH muscle subunit; LDH-A; LDH-M; LDH1; ldha; LDHA_HUMAN; LDHBD; LDHM; MS1111; PIG19; Proliferation inducing gene 19; Proliferation-inducing gene 19; Renal carcinoma antigen NY REN 46; Renal carcinoma antigen NY-REN-59; TRG 5; TRG5

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

5-323aa

Target Protein Sequence

KDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

35.1 kDa

Protein Length

Partial

Tag Info

Tag-Free

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

This recombinant Human LDHA protein is an E.coli expressed partial protein with Tag-Free and its purity is 85%+ determined by SDS-PAGE. With the appropriate cDNA and PCR methods, LDHA expression plasmids can be rapidly produced. which must undergo denaturation and folding cycle, can be recovered with more modest yields. Hence, using small-scale fermentations and laboratory-scale processing equipment, LDHA proteins (or subdomains thereof) can usually be produced in sufficient quantities to initiate most studies including detailed structural determinations.which must undergo denaturation and folding cycle, can be recovered with more modest yields. Hence, using small-scale fermentations and laboratory-scale processing equipment, LDHA proteins (or subdomains thereof) can usually be produced in sufficient quantities to initiate most studies including detailed structural determinations.

LDHA is a critical glycolytic enzyme that promotes aerobic glycolysis in the cells by catalyzing the interconversion of pyruvate and lactate. It contributes to the increase in glucose uptake and lactate generation in tumor cells and is important for cancer invasion and immune infiltration. High expression of LDHA has been found in a variety of malignancies such as breast cancer, liver cancer, and oral squamous cell carcinoma and has been linked to tumor volume, stage, and degree of cell differentiation as well as affected disease-free survival (DFS) and overall survival (OS). LDHA has recently been associated with lactic acid-related tumor immune infiltration and immune escape.

Target Background

Gene References into Functions

The study reveals that miR-33b plays a suppressive role in the regulation of osteosarcoma cell proliferation through direct targeting LDHA. PMID: 30213286
hCINAP determines self-renewal of colorectal cancer stem cells by facilitating LDHA phosphorylation. PMID: 28516914
the results of the present study demonstrated that miR199a3p can inhibit LDHA expression by downregulating Sp1, and provided mechanistic evidence supporting the existence of a novel miR199a3p/Sp1/LDHA axis and its critical contribution to aerobic glycolysis in testicular cancer cells. PMID: 30015851
High LDHA expression is associated with Non-Small Cell Lung Cancer. PMID: 29321091
This is the first study from this highly prevalent region of Head neck cancer showing that serum LDH could be regarded as a biomarker for malignant and premalignant conditions of the head and neck. PMID: 30197328
High LDH expression is associated with small cell lung cancer. PMID: 29970686
The PFK2 expression along with LDH-4 were observed to be increased ~2-fold (P < 0.001) in 0.5 mM ammonia treated brain slices. PMID: 23703029
miR-199a-3p is a major metabolic regulator in tumor suppression and miR-199a-3p may downregulate metabolic genes (LDHA, PGK1, MCT1, TIGAR) through the transcription factor Sp1. PMID: 27432288
The expression of LDH-5 and hypoxia-inducible factor (HIF) 1alpha in Non-Hodgkin's lymphoma, was examined. PMID: 24086384
Results show that LDHA is highly expressed in triple negative breast cancer (TNBC) and correlated with a poor outcome. Its 3'UTR is targeted by miR-34a. Also, LDHA along with PDL1 seem to act as ceRNAs to promote the expression and function of each other through regulation of miR-34a in TNBC. PMID: 28915924
LDHA siRNA can inhibit cell proliferation, induce apoptosis, reduce invasion and migration in renal cell carcinoma cells. PMID: 27027898
JMJD2A regulated aerobic glycolysis by regulating LDHA expression. Therefore, the novel JMJD2A-LDHA signaling pathway could contribute to the Warburg effects in NPC progression. PMID: 28693517
The present study proved that HIF1/2alpha could activate LDHA expression in human pancreatic cancer cells, and high expression of LDHA promoted the growth and migration of pancreatic cancer cells. PMID: 28193910
Pretreatment LDH levels had noticeable prognostic value in advanced pancreatic ductal adenocarcinoma (PDAC) patients who received subsequent chemotherapy. Tackling elevated LDH levels before the initiation of chemotherapy might be a promising measure for improving overall survival of patients after treatment for their advanced PDAC. PMID: 28056913
Authors demonstrated that knock down of LDHA with siRNA or inhibition of LDHA activity with a LDHA specific inhibitor (FX-11), could sensitize PC-3RR cells to radiotherapy with reduced epithelial-mesenchymal transition, hypoxia, DNA repair ability and autophagy, as well as increased DNA double strand breaks and apoptosis. PMID: 27708237
Taken together, these results indicate that miR-142-3p could act as a tumor suppressor in HCC by targeting LDHA, suggesting new therapeutic targets for HCC treatment. PMID: 29360449
Findings suggest that miR-34b-3 and miR-449a suppress the development of nasopharyngeal carcinoma (NPC) through regulation of glycolysis via targeting lactate dehydrogenase A.(LDHA) and may be potential therapeutic targets for the treatment of NPC. PMID: 27458165
Results provide evidence that miR-200b acts as a tumor suppressor in glioma through the inhibition of LDHA both in vitro and in vivo. PMID: 27374173
our data demonstrate that overexpression of 14-3-3zeta in early stage pre-cancerous breast epithelial cells may trigger an elevated glycolysis and transcriptionally up-regulating LDHA, thereby contributes to human breast cancer initiation. PMID: 27150057
serum lactate dehydrogenase has a role in predicting the outcome of resected gastric cancer and construct prognostic nomograms for risk prediction PMID: 27223065
LDHA phosphorylation and activation provide pro-invasive, anti-anoikis and pro-metastatic advantages to cancer cells, suggesting that Y10 phosphorylation of LDHA may represent a promising therapeutic target and a prognostic marker for metastatic human cancers. PMID: 28218905
miR-30a-5p may function as a tumor suppressor in breast cancer through the inhibition of LDHA expression and glycolysis. PMID: 28461244
Overexpression of LDHA can be a marker of poor prognosis in cholangiocarcinoma patients PMID: 27615379
LDHA-associated lactic acid accumulation in melanomas inhibits tumor surveillance by T and natural killer cells. PMID: 27641098
Data indicate that lactate dehydrogenase A (LDHA) is involved in the transcription of histone 2B gene. PMID: 28257841
LDHA downregulation is involved in the apoptotic effect of diallyl trisulfide in triple-negative breast cancer. PMID: 27566995
this study shows that low levels of LDH correlate to a better anti-CTLA-4 immunotherapy response and survival in advanced melanoma patients PMID: 27728898
alternative isoforms of LDH in cancer cells produce lactic acid, when LDHA is silenced or inhibited PMID: 28314283
Overexpression of PKM2 and LDH5 associates with key clinicopathological features and unfavourable prognosis in tongue squamous cell carcinoma. PMID: 24762230
These results suggest LDH-A and/or lactate as common elements at the cross-road between cancer cell metabolism, tumor progression and inflammation PMID: 27622920
High serum LDH is associated with OS and PFS in patients with urinary system cancer, and it is an effective biomarker of prognosis in patients with urologic cancer. PMID: 27710971
High serum LDH level is associated with cancer. PMID: 27511116
The number of in advanced-stage diffuse large B cell lymphoma patients with elevated serum lactate dehydrogenase who achieved complete response (CR) after R-CHOP in the non autologous hematopoietic stem cell transplantation (ASCT) group was higher than that in the ASCT group. PMID: 27324387
this study shows that elevated serum LDH levels are associated with unfavorable prognosis in nasopharyngeal carcinoma patients treated with intensity-modulated radiotherapy PMID: 26928265
LDHA is a direct target of miR-34a in regulating glucose metabolism and tumor growth in breast cancer. PMID: 26902416
IDO, through GCN2 kinase activation, downregulates the levels of TCRcomplex tchain and cMyc, resulting in the suppression of Tcell proliferation and a reduction in the levels of LDHA and GLS2 PMID: 26647830
Findings provide evidence of the cellular functions of lactate dehydrogenase A in the progression of glioblastoma and suggest that lactate dehydrogenase A might act as a potential therapeutic target for glioblastoma treatment. PMID: 26694942
Reanalysis of genome-wide association study and in vitro validation show that lactate dehydrogenase interacts with branched-chain amino acid metabolism. PMID: 26014429
LDH and complex I play distinct roles in regulating glycolysis and cell proliferation. Inhibition of these two augments synthetic lethality in melanoma. PMID: 26484566
Multivariable analysis showed that combined expression of pyruvate kinase type M2 and lactate dehydrogenase A was an independent poor prognostic marker for survival. PMID: 26989901
Although lactate dehydrogenase A (LDHA) expression varies biphasically during melanoma brain metastasis formation, tumor progression and survival seem to be functionally independent of LDHA. PMID: 25791837
dehydrogenase A negatively regulated by miRNAs promotes aerobic glycolysis and is increased in colorectal cancer. PMID: 26062441
positive relationship between LDH-A expression and CSC/EMT markers was confirmed both in invasive bladder cell line and in 136 MIBC specimens. PMID: 26721441
FOXM1-LDHA signaling functioned as a stimulator of glycolysis and promoted gastric cancer progression. PMID: 26261559
Mammalian photoreceptors contain dimeric and tetrameric PKM2 and LDH-A. This is consistent with the ability to switch between energy production and biosynthesis like a proliferating tissue, possibly due to demands of opsin synthesis. PMID: 26780311
We propose a profibrotic feed forward loop, in which radiation induces LDHA expression and lactate production, which can lead to further activation of TGF-beta to drive the fibrotic process. PMID: 26254422
These results indicate that disrupting SLC2A1, LDHA, or other regulators in cancer cell energetics is a very promising approach for new targeted therapies. PMID: 25838393
High expression of LDHA is associated with gastric cancer. PMID: 25913622
High LDHA expression is associated with tumor progression in prostate cancer. PMID: 25983002
LDHA is downregulated by JQ1, which suppresses tumor growth in ovarian cancer PMID: 25762632

Hide All

Involvement in disease

Glycogen storage disease 11 (GSD11)

Subcellular Location

Cytoplasm.

Protein Families

LDH/MDH superfamily, LDH family

Database Links

HGNC: 6535

OMIM: 150000

KEGG: hsa:3939

STRING: 9606.ENSP00000445175

UniGene: Hs.2795

Code	CSB-EP012832HU1e1
Abbreviation	Recombinant Human LDHA protein, partial
MSDS	MSDS Datasheet
Size	$390
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human L-lactate dehydrogenase A chain (LDHA), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage