Code | CSB-EP012832HU1e1 |
Size |
$1978Purchase it in Cusabio online store (only available for customers from the US) |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
Description |
This recombinant Human LDHA protein is an E.coli expressed partial protein with Tag-Free and its purity is 85%+ determined by SDS-PAGE. With the appropriate cDNA and PCR methods, LDHA expression plasmids can be rapidly produced. which must undergo denaturation and folding cycle, can be recovered with more modest yields. Hence, using small-scale fermentations and laboratory-scale processing equipment, LDHA proteins (or subdomains thereof) can usually be produced in sufficient quantities to initiate most studies including detailed structural determinations.which must undergo denaturation and folding cycle, can be recovered with more modest yields. Hence, using small-scale fermentations and laboratory-scale processing equipment, LDHA proteins (or subdomains thereof) can usually be produced in sufficient quantities to initiate most studies including detailed structural determinations. LDHA is a critical glycolytic enzyme that promotes aerobic glycolysis in the cells by catalyzing the interconversion of pyruvate and lactate. It contributes to the increase in glucose uptake and lactate generation in tumor cells and is important for cancer invasion and immune infiltration. High expression of LDHA has been found in a variety of malignancies such as breast cancer, liver cancer, and oral squamous cell carcinoma and has been linked to tumor volume, stage, and degree of cell differentiation as well as affected disease-free survival (DFS) and overall survival (OS). LDHA has recently been associated with lactic acid-related tumor immune infiltration and immune escape. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Target Names | LDHA |
Uniprot No. | P00338 |
Research Area | Metabolism |
Alternative Names | Cell proliferation-inducing gene 19 protein; GSD11; L lactate dehydrogenase B chain; L-lactate dehydrogenase A chain; Lactate dehydrogenase A; Lactate dehydrogenase B; Lactate dehydrogenase c variant 1; Lactate dehydrogenase c variant 3; Lactate dehydrogenase c variant 4; Lactate dehydrogenase C4; Lactate dehydrogenase H chain; Lactate dehydrogenase M; LDH A; LDH B; LDH H; LDH heart subunit; LDH M; LDH muscle subunit; LDH-A; LDH-M; LDH1; ldha; LDHA_HUMAN; LDHBD; LDHM; MS1111; PIG19; Proliferation inducing gene 19; Proliferation-inducing gene 19; Renal carcinoma antigen NY REN 46; Renal carcinoma antigen NY-REN-59; TRG 5; TRG5 |
Species | Homo sapiens (Human) |
Source | E.coli |
Expression Region | 5-323aa |
Target Protein Sequence | KDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTL Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Mol. Weight | 35.1 kDa |
Protein Length | Partial |
Tag Info |
Tag-Free |
Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | 3-7 business days |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Gene References into Functions |
|
Involvement in disease | Glycogen storage disease 11 (GSD11) |
Subcellular Location | Cytoplasm. |
Protein Families | LDH/MDH superfamily, LDH family |
Database Links |
HGNC: 6535 OMIM: 150000 KEGG: hsa:3939 STRING: 9606.ENSP00000445175 UniGene: Hs.2795 |