Recombinant Human LIM domain transcription factor LMO4 (LMO4)

Code CSB-EP013011HU
Abbreviation Recombinant Human LMO4 protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
LMO4
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
Breast tumor autoantigen; LIM domain only 4; LIM domain only protein 4; LIM domain transcription factor LMO 4; LIM domain transcription factor LMO4; LMO 4; LMO-4; LMO4; LMO4_HUMAN; OTTHUMP00000011905; OTTHUMP00000011906
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-165aa
Target Protein Sequence
MVNPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGTSCYTKSGMILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHDRPTALINGHLNSLQSNPLLPDQKVC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
45.0kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Probable transcriptional factor.
Gene References into Functions
  1. Lmo4 participates in the regulation of lung epithelial cell proliferation but is not essential for tumor progression. PMID: 26048572
  2. LMO4 appears to form a hub in protein-protein interaction networks, linking numerous pathways within cells. PMID: 25310299
  3. Clim2, in a complex with LMO4, supports mammary stem cells by directly targeting the Fgfr2 promoter in basal cells to increase its expression PMID: 25079073
  4. Existence of a region in the lateral portion of the mammalian cochlea that is competent to make an organ of Corti is demonstrated in the absence of LMO4 function. PMID: 25057208
  5. Low LMO4 mRNA levels were associated with response to erlotinib in non-small-cell lung cancer. PMID: 23407556
  6. oncoprotein HBXIP is able to activate the transcriptional coregulatory protein LMO4 through transcription factor Sp1 in promotion of proliferation of breast cancer cells. PMID: 23291272
  7. Data suggest that overexpression of LMO4 may disrupt some of the normal tumour suppressor activities of CtIP, thereby contributing to breast cancer progression. PMID: 23353824
  8. the association of high levels of LMO4 with aggressive neuroblastomas is dependent on LMO4 regulation of cadherin expression and hence, tumor invasiveness PMID: 23407937
  9. LMO4 is a direct target of p53 and inhibits p53-mediated proliferative inhibition of breast cancer cells through interacting p53 PMID: 22906635
  10. LMO4 is over-expressed in highly invasive rhabdomyosarcoma, alveolar cells PMID: 21271214
  11. LMO4 expression in squamous cell carcinoma of the anterior tongue PMID: 21362019
  12. data indicate that LMO4 has similar cellular effects in normal mammary epithelial cells and breast cancer cells, and also provide direct evidence for the idea that normal development and carcinogenesis share conserved molecular mechanisms PMID: 20526802
  13. LMO4 protects neurons from ischemic brain injury, in part through its requirement as an essential cofactor of PPAR gamma PMID: 19020036
  14. These findings reveal a novel complex between BRCA1, LMO4, and CtIP and indicate a role for LMO4 as a repressor of BRCA1 activity in breast tissue. PMID: 11751867
  15. 1H, 15N and 13C assignments of FLIN4, an intramolecular LMO4:ldb1 complex PMID: 12153047
  16. Lmo4 RNA overexpression interferes with neuritic outgrowth,anti-sense Lmo4 RNA expression favors neuritogenesis in SH-SY5Y cells. Changes in Lmo4 RNA expression levels might alter the rate of neuritic outgrowth in the developing and adult nervous system. PMID: 12877980
  17. LMO4 interaction modulates the interleukin-6 receptor subunit glycoprotein 130 complex and its signaling PMID: 15677447
  18. LMO4 is consistently more highly expressed in the embryonic right perisylvian cerebral cortex than in the left PMID: 15894532
  19. LMO4 in breast epithelium contributes directly to breast neoplasia by altering the rate of cellular proliferation and promoting cell invasion. PMID: 15897450
  20. Artificial intramolecular cyclic protein complex between two interacting proteins: the largely unstable LIM-only protein 4 (LMO4) and an unstructured domain of LIM domain binding protein 1 (ldb1). PMID: 17001033
  21. In this study, patients whose tumours exhibited high LMO4 expression had a significant survival advantage following operative resection PMID: 18231110
  22. Results suggested that LMO4 is overexpressed at late stages in carcinogenesis of pancreatic cancer. PMID: 19099607
  23. Lmo4 expression coincides with the timing of the development of the somatosensory barrel field. PMID: 19111533
  24. LMO4 is a novel cell cycle regulator with a key role in mediating ErbB2-induced proliferation, a hallmark of ErbB2-positive disease. PMID: 19648968

Show More

Hide All

Database Links

HGNC: 6644

OMIM: 603129

KEGG: hsa:8543

STRING: 9606.ENSP00000359573

UniGene: Hs.436792

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*