Recombinant Human LIM domain transcription factor LMO4(LMO4)

Code CSB-EP013011HU
Product Type Recombinant Protein
Size US$2466
Uniprot No. P61968
Relevance Probable transcriptional factor.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Breast tumor autoantigen LIM domain only protein 4
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MVNPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGTSCYTKSGMILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHDRPTALINGHLNSLQSNPLLPDQKVC
Research Area Epigenetics and Nuclear Signaling
Source E.coli
Gene Names LMO4
Protein Names Recommended name: LIM domain transcription factor LMO4 Alternative name(s): Breast tumor autoantigen LIM domain only protein 4 Short name= LMO-4
Expression Region 1-165aa
Tag Info N-terminal GST-tagged
Mol. Weight 45.0kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Probable transcriptional factor.
Database Links

HGNC: 6644

OMIM: 603129

KEGG: hsa:8543

STRING: 9606.ENSP00000359573

UniGene: Hs.436792

Related Products

LMO4 Antibodies

LMO4 Antibodies for Homo sapiens (Human)

LMO4 Antibodies for Human

LMO4 Proteins

LMO4 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.