| Code | CSB-BP012898HU |
| MSDS | |
| Size | Pls inquire |
| Source | Baculovirus |
| Have Questions? | Leave a Message or Start an on-line Chat |
| Code | CSB-EP012898HU-B |
| MSDS | |
| Size | Pls inquire |
| Source | E.coli |
| Conjugate | Avi-tag Biotinylated E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag. |
| Have Questions? | Leave a Message or Start an on-line Chat |
| Code | CSB-MP012898HU |
| MSDS | |
| Size | Pls inquire |
| Source | Mammalian cell |
| Have Questions? | Leave a Message or Start an on-line Chat |
There are currently no reviews for this product.
Regarding protein produced with baculovirus, did you use insect cells for production or how is the protein produced, what is the Tag sequence?
For the baculovirus expression system, we produced the protein with SF9 cells.
Tags: N-terminal 10xHis-tagged and C-terminal Myc-tagged
The full sequence of the protein is as follows:
MDHHHHHHHHHHLVPRGSRT+KKPAKPKCPAVCTCTKDNALCENARSIPRTVPPDVISLSFVRSGFTEISEGSFLFTPSLQLLLFTSNSFDVISDDAFIGLPHLEYLFIENNNIKSISRHTFRGLKSLIHLSLANNNLQTLPKDIFKGLDSLTNVDLRGNSFNCDCKLKWLVEWLGHTNATVEDIYCEGPPEYKKRKINSLSSKDFDCIITEFAKSQDLPYQSLSIDTFSYLNDEYVVIAQPFTGKCIFLEWDHVEKTFRNYDNITGTSTVVCKPIVIETQLYVIVAQLFGGSHIYKRDSFANKFIKIQDIEILKIRKPNDIETFKIENNWYFVVADSSKAGFTTIYKWNGNGFYSHQSLHAWYRDTDVEYLEIVRTPQTLRTPHLILSSSSQRPVIYQWNKATQLFTNQTDIPNMEDVYAVKHFSVKGDVYICLTRFIGDSKVMKWGGSSFQDIQRMPSRGSMVFQPLQINNYQYAILGSDYSFTQVYNWDAEKAKFVKFQELNVQAPRSFTHVSINKRNFLFASSFKGNTQIYKHVIVDLSA+AAAEQKLISEEDL-
10xHis: HHHHHHHHHH
Thrombin site: LVPRGS
Linker: RT
Myc-Tag: EQKLISEEDL