Recombinant Human Metalloproteinase inhibitor 3 (TIMP3), partial

In Stock
Code CSB-EP023562HU1
Abbreviation Recombinant Human TIMP3 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
TIMP3
Uniprot No.
Research Area
Neuroscience
Alternative Names
HSMRK222; K222; K222TA2; Metalloproteinase inhibitor 3; MIG 5 protein; MIG5 protein ; Protein MIG 5; Protein MIG-5; SFD; Sorsby fundus dystrophy pseudoinflammatory; TIMP 3; TIMP metallopeptidase inhibitor 3; TIMP-3; TIMP3; TIMP3_HUMAN; Tissue Inhibitor of Metalloproteinase 3; Tissue inhibitor of metalloproteinases 3; Tissue inhibitor of metalloproteinases3
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
30-208aa
Target Protein Sequence
HPQDAFCNSDIVIRAKVVGKKLVKEGPFGTLVYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
24.8kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Experience the excellence of our Recombinant Human TIMP3 protein, carefully crafted to aid your neuroscience research endeavors. Derived from E. coli expression systems, this partial protein (30-208aa) features an N-terminal 6xHis-tag, ensuring efficient purification and identification. With a purity greater than 90% as assessed by SDS-PAGE, our TIMP3 protein is guaranteed to deliver reliable and reproducible results.

Investigate the fascinating world of metalloproteinase inhibitors and their roles in neural processes with our high-quality recombinant protein. Available in both liquid and lyophilized powder forms, our Recombinant Human TIMP3 protein is an indispensable asset for your neuroscience research toolkit.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. May form part of a tissue-specific acute response to remodeling stimuli. Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-9, MMP-13, MMP-14 and MMP-15.
Gene References into Functions
  1. Genetic variation in the TIMP-3 gene may contribute to individual differences in mixture plaque susceptibility in the Han Chinese population. PMID: 29498555
  2. TIMP3 methylation is a marker for TN tumours and furthermore we showed for the first time that TIMP3 promoter methylation is an epigenetic marker of BRCA1ness tumours. PMID: 29524167
  3. As a novel CLOCK-dependent diurnal gene, TIMP3 inhibits the expression of inflammatory cytokines that are up-regulated by UV irradiation in human keratinocytes. PMID: 29180440
  4. miR-21-5p mediates apoptosis by targeting PTEN and TIMP3. PMID: 29393355
  5. Preliminary studies indicate that baseline MMP3 and TIMP3 concentrations are associated with patient survival and disease-free time PMID: 29304854
  6. TIMP-3 mRNA expression levels positively correlates with levels of miR-21 in in situ breast carcinomas and negatively in progesterone receptor positive invasive breast carcinomas. PMID: 28935174
  7. Sphingosine-1-phosphate inhibited cell migration and MMP-2 expression through the upregulation of the tissue inhibitor of metalloproteinase-3 (TIMP-3) expression in human chondrosarcoma cells. PMID: 28672103
  8. Using global proteomic profiling of brain leptomeningeal arteries, this study revealed that clusterin and tissue inhibitor of metalloproteinases-3 increase in leptomeningeal arteries affected by cerebral amyloid angiopathy. PMID: 27543695
  9. This is the first report of a syndromic Sorsby fundus dystrophy in line with the mouse model uncovering the role of TIMP3 in human lung morphogenesis and functions. PMID: 27601084
  10. Collectively, these results demonstrated that IL-32alpha upregulates the atheroprotective genes Timp3 and Reck by downregulating microRNA-205 through regulation of the Rprd2-Dgcr8/Ddx5-Dicer1 biogenesis pathway. PMID: 28740544
  11. MMP-13 may play a role on physiological turnover of cartilage extracellular matrix and that LRP1 is a key modulator of extracellular levels of MMP-13 and its internalization is independent of the levels of ADAMTS-4, -5 and TIMP-3. PMID: 27084377
  12. we show that KDM1A promotes cancer metastasis in non-small cell lung cancer cells by repressing TIMP3 (tissue inhibitor of metalloproteinase 3) expression. PMID: 27058897
  13. Dissecting the interaction between TIMP3 and LRP1 using a synthetic analog of the LRP1 receptor has been reported. PMID: 27476612
  14. These results implicate TIMP3 as a modulator of cell surface GHR abundance and the ability of GH to promote cellular signaling. PMID: 27075707
  15. native glycosaminoglycans interact with TIMP-3. PMID: 27545813
  16. The expression level of LIPC, SLC16A8, and TIMP-3 was significantly associated with age-related macular degeneration pathology. PMID: 27966779
  17. Levels of miR-221/222 are associated negatively with estrogen receptor in in situ tumors and positively with tissue inhibitor of metalloproteinase 3 TIMP3 messenger RNA expression levels in pure invasive breast cancers. PMID: 27488105
  18. Electrostatic potential calculations suggested a competition between negatively charged GAGs and highly negatively charged complement-like domains of LRP-1 for the binding to a positively charged area of TIMP-3 as an underlying mechanism. PMID: 27610455
  19. TIMP3 overexpression after myocardial infarction improves myocardial structural remodeling and function by promoting angiogenesis and inhibiting early proteolysis. PMID: 28550172
  20. Single Nucleotide Variants of Candidate Genes in Aggrecan Metabolic Pathway Are Associated with Lumbar Disc Degeneration and Modic Changes PMID: 28081267
  21. Our data suggest that miR-206 may function as an inflammatory regulator and drive the expression of MMP9 in M.tb-infected THP-1 cells by targeting TIMP3, indicating that miR-206 is a potential therapeutic target for patients with TB. PMID: 27291149
  22. Plasma TIMP3 is a biomarker for predicting the tumor stage in patients with oral squamous cell carcinoma . PMID: 28138307
  23. TIMP-3 K26A/K45A retained higher affinity for sulfated glycosaminoglycans than K42A/K110A and exhibited increased affinity for ADAMTS-5 in the presence of heparin. PMID: 27582494
  24. Of the 225 genetic tests performed, 150 were for recessive IRD, and 75 were for dominant IRD. A positive molecular diagnosis was made in 70 (59%) of probands with recessive IRD and 19 (26%) probands with dominant IRD. Thirty-two novel variants were identified; among these, 17 sequence changes in four genes were predicted to be possibly or probably damaging including: ABCA4 (14), BEST1 (2), PRPH2 (1), and TIMP3 PMID: 28005406
  25. Study evaluated MMP-12 and TIMP-1, TIMP-2, TIMP-3, and TIMP-4 levels in 40 patients with asymptomatic and symptomatic critical carotid artery stenosis (CAS) with neurologic symptoms onset within the preceding 12 hours; results suggest that MMP-12 is related to critical CAS independently on symptoms, moreover, TIMP-3 and TIMP-4 seem to be specifically related to stroke PMID: 27746079
  26. A total of 1096 subjects from eight studies were included in the present meta-analysis. Overall, a significant association between TIMP-3 methylation and gastric cancer risk was observed (OR = 8.65; 95% CI4.31-17.37; p < 0.001). Our results show a positive correlation between TIMP-3 promoter methylation and gastric cancer risk and that TIMP-3 promoter methylation may be used as a molecular marker for gastric cancer PMID: 27314831
  27. TIMP-3 expression is suppressed by promoter methylation in HCC. PMID: 27222429
  28. Both TIMP3 and APC methylation were associated with lymph node metastasis and higher clinical stage of tumors. Patients with methylation at TIMP3 or APC had worse prognoses as compared to those without these alterations. PMID: 27706614
  29. Data indicate the TGF-beta pathway regulates the epithelial-to-mesenchymal transition (EMT) of gastric cancer cells by increasing the levels of microRNA miRNA-181b to target Timp3 via the Smad2/3/4-dependent pathway. PMID: 27383203
  30. Study identifies 2 urinary biomarkers-bFGF and TIMP3-that successfully detect one of the most common pediatric brain tumors, juvenile pilocytic astrocytomas, with high accuracy PMID: 27314542
  31. the levels of TIMP-3, and in some cases also TIMP-2, are decreased in Emery-Dreifuss muscular dystrophy (EDMD). The decrease might be associated with an adverse effect on matrix metalloproteinases and remodelling of the myocardial matrix. The specific decrease of TIMP-3 indicates that this biomarker might help in early detection of cardiac involvement in EDMD. PMID: 25563468
  32. TIMP3 knockdown had opposite effects on the regulation of these genes. PMID: 26749283
  33. This case series suggests the C113G TIMP3 variant may represent a novel highly penetrant mutation causing choroidal neovascularisation of relatively late onset for Sorsby's fundus dystrophy, mimicking early onset AMD. PMID: 26493035
  34. expression of TIMP3 is low in pituitary adenomas including ACTH-secreting pituitary adenomas and negatively associated with tumor aggressiveness. PMID: 26676407
  35. Genotypes of rs135025 and rs80272 in TIMP3 contribute to the development of preeclampsia in Han Chinese women. PMID: 26304100
  36. TIMP3 was validated as a direct target of miRNA-21 by dual-luciferase reporter assay. Silencing with small interfering RNA against TIMP3 promoted angiogenesis and increased MMP2 and MMP9 expression at the protein level. PMID: 26872030
  37. TIMP3 is a dominant negative regulator of angiogenesis in cutaneous melanoma and gene silencing by promoter methylation is associated with poor outcome PMID: 26707830
  38. Taken together, our results suggest that the imbalance between aggrecanase and TIMP-3 may play an important role in the pathogenesis of IDD and therefore be a potential therapeutic target for treating IDD. PMID: 26686417
  39. Gene-gene interactions between Smad3 rs6494629T/C and TIMP3 rs715572G/A polymorphisms may play more important protective roles in knee OA. PMID: 26068512
  40. Results suggest that gene-environment interactions between the TIMP3 rs9862 polymorphisms and betel quid may alter oral cancer susceptibility and tumor growth in Taiwanese men. PMID: 26579821
  41. following acute ACL injury, an upregulation of TIMP-3, the primary aggrecanase inhibitor, is elicited in response to increased aggrecan degradation, which may inhibit further cleavage PMID: 26123869
  42. TIMP3) promotes endothelial apoptosis via a caspase-independent mechanism. PMID: 25558000
  43. This data shows that increased expression of miR-21 enhanced the invasive potential of melanoma cell lines through TIMP3 inhibition. PMID: 25587717
  44. The miR-191-TIMP3 axis might be critical in the malignant transformation of endometriosis to endometriosis-associated ovarian cancer. PMID: 25819812
  45. TIMP-3 expression was associated with malignant behaviors of hepatocellular carcinoma, including portal vein invasion and lymph node metastasis. TIMP-3 expression was an independent prognostic factor for disease-free survival and overall survival PMID: 25171061
  46. TIMP3 methylation had prognostic value in patients with glioblastoma multiforme. PMID: 25467143
  47. This study expands the spectrum of mutations in the TIMP3 gene and associated phenotypic findings. Imaging using late-phase ICG-A may be useful for early identification of individuals at risk for developing SFD. PMID: 25766588
  48. The hypermethylation frequencies of TIMP-3 and GSTP-1 of reversible chronic inflammatory gum disease and the control group were similar, but both were significantly lower than those for malignant disease patients. PMID: 25041782
  49. HPV-positive oropharyngeal squamous cell carcinoma is associated with TIMP3 and CADM1 promoter hypermethylation. PMID: 25065733
  50. Report no association of TIMP3 genetic polymorphisms with thoracic aortic dissection in Chinese Han population. PMID: 24487965

Show More

Hide All

Involvement in disease
Sorsby fundus dystrophy (SFD)
Subcellular Location
Secreted, extracellular space, extracellular matrix.
Protein Families
Protease inhibitor I35 (TIMP) family
Database Links

HGNC: 11822

OMIM: 136900

KEGG: hsa:7078

STRING: 9606.ENSP00000266085

UniGene: Hs.644633

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*