Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Neuroscience
Alternative Names
HSMRK222; K222; K222TA2; Metalloproteinase inhibitor 3; MIG 5 protein; MIG5 protein ; Protein MIG 5; Protein MIG-5; SFD; Sorsby fundus dystrophy pseudoinflammatory; TIMP 3; TIMP metallopeptidase inhibitor 3; TIMP-3; TIMP3; TIMP3_HUMAN; Tissue Inhibitor of Metalloproteinase 3; Tissue inhibitor of metalloproteinases 3; Tissue inhibitor of metalloproteinases3
Species
Homo sapiens (Human)
Expression Region
30-208aa
Target Protein Sequence
HPQDAFCNSDIVIRAKVVGKKLVKEGPFGTLVYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINA
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Experience the excellence of our Recombinant Human TIMP3 protein, carefully crafted to aid your neuroscience research endeavors. Derived from E. coli expression systems, this partial protein (30-208aa) features an N-terminal 6xHis-tag, ensuring efficient purification and identification. With a purity greater than 90% as assessed by SDS-PAGE, our TIMP3 protein is guaranteed to deliver reliable and reproducible results.
Investigate the fascinating world of metalloproteinase inhibitors and their roles in neural processes with our high-quality recombinant protein. Available in both liquid and lyophilized powder forms, our Recombinant Human TIMP3 protein is an indispensable asset for your neuroscience research toolkit.
