Recombinant Human Mitochondrial import receptor subunit TOM40 homolog (TOMM40)

In Stock
Code CSB-EP024050HU
Abbreviation Recombinant Human TOMM40 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP024050HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TOMM40.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP024050HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TOMM40.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
TOMM40
Uniprot No.
Research Area
Tags & Cell Markers
Alternative Names
C19orf1; D19S1177E; Haymaker protein; Mitochondrial import receptor subunit TOM40 homolog; Mitochondrial outer membrane protein; Mitochondrial outer membrane protein TOM40; p38.5; PER EC1; PEREC1; Probable mitochondrial import receptor subunit TOM40 homolog; Protein Haymaker; TOM40; TOM40_HUMAN; TOMM40; Translocase of outer membrane 40 kDa subunit homolog; Translocase of outer mitochondrial membrane 40; Translocase of outer mitochondrial membrane 40 homolog (yeast); Translocase of outer mitochondrial membrane 40 homolog; Translocase of outer mitochondrial membrane 40, yeast, homolog of
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-361aa
Target Protein Sequence
MGNVLAASSPPAGPPPPPAPALVGLPPPPPSPPGFTLPPLGGSLGAGTSTSRSSERTPGAATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQMEGVKLTVNKGLSNHFQVNHTVALSTIGESNYHFGVTYVGTKQLSPTEAFPVLVGDMDNSGSLNAQVIHQLGPGLRSKMAIQTQQSKFVNWQVDGEYRGSDFTAAVTLGNPDVLVGSGILVAHYLQSITPCLALGGELVYHRRPGEEGTVMSLAGKYTLNNWLATVTLGQAGMHATYYHKASDQLQVGVEFEASTRMQDTSVSFGYQLDLPKANLLFKGSVDSNWIVGATLEKKLPPLPLTLALGAFLNHRKNKFQCGFGLTIG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
64.9kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant Human TOMM40 protein is produced by constructing the recombinant plasmid encoding the Human TOMM40 protein (1-361aa), transforming recombinant plasmid into e.coli cells, screening the positive e.coli cells and culturing them, and inducing the protein expression. The protein is equipped with a N-terminal GST tag. Following expression, the recombinant TOMM40 protein is isolated and purified from the cell lysate using affinity purification. Denaturing SDS-PAGE is then employed to resolve the resulting recombinant Human TOMM40 protein. Its purity is greater than 90%.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Channel-forming protein essential for import of protein precursors into mitochondria. Plays a role in the assembly of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) by forming a complex with BCAP31 and mediating the translocation of Complex I components from the cytosol to the mitochondria.
Gene References into Functions
  1. TOM40 over-expression blocked Ab-elicited decreases in the mitochondrial membrane potential, cellular ATP levels, and cellular viability in the control cells. These data suggest elevated expression of TOM40 may be protective of mitochondrial function. PMID: 28768149
  2. PPARgamma knockdown resulted in increased levels of TOMM40, APOE and APOC1 -mRNAs, showing the strongest impact on APOE transcript levels. PMID: 28065845
  3. Results from this exploratory analysis suggest that regulatory element methylation levels within the larger TOMM40-APOE-APOC2 gene region correlate with AD-related biomarkers and TOMM40 or APOE gene expression in AD. PMID: 29371683
  4. This study demonstrated that the association of TOMM40 '523-L with cognitive decline is primarily mediated by common neuropathologies. By contrast, the association of TOMM40 '523-S/S is relatively independent of these pathologies. PMID: 28624335
  5. This study found in middle-aged and aged cohorts that FH altered TOMM40 '523 poly-T genotype associations on memory, and additionally in aged participants for both global decline and cognitive impairment risk. PMID: 28549947
  6. Our data provide support for TOMM40 variant repeat length as an important contributor to AD-like Medial Temporal Lobe pathology in the absence of APOE epsilon4. PMID: 28183529
  7. Survival analyses suggest that AD patients with TOMM40 allele rs2075650-G have an average age of disease onset of 6 years earlier compared with carriers of the A allele. The age of disease onset is earlier if APOE4/4 is present in the Colombian population studied. PMID: 27023435
  8. report association of APOE and TOMM40 with behavioural variant frontotemporal dementia, and ARHGAP35 and SERPINA1 with progressive non-fluent aphasia. PMID: 28387812
  9. Among white women, three single nucleotide polymorphisms (SNPs) (rs2075650 [TOMM40], rs4420638 [APOC1], and rs429358 [APOE]) were significantly associated with survival to 90 years after correction for multiple testing (p < .001); rs4420638 and rs429358 were also significantly associated with healthy aging (p = .02). In African American women, no SNP was associated with longevity. In Hispanic women, 7 SNPs in linkage dise PMID: 27707806
  10. Each epsilon4 allele doubled the risk for AD dementia and the dose effect was evident. Almost identical effect size and effect pattern were observed for TOMM40 '523-L PMID: 28672022
  11. meta-analysis to investigate the association between rs2075650 polymorphism and Alzheimer's disease (AD) in Asian, Caucasian, and mixed populations; analysis shows TOMM40 rs2075650 polymorphism is associated with AD susceptibility in Asian, Caucasian, and mixed populations PMID: 27328316
  12. Results reveal an association of APOE epsilon3/3-TOMM40'523 haplotypes with cognitive decline in community-based older persons such that the S/S poly-T genotype is related to faster cognitive decline, primarily in the domains of episodic and semantic memory. PMID: 28108637
  13. These findings indicated that variants in TOMM40/APOE/APOC1 region might be associated with human longevity. Further studies are needed to identify the causal genetic variants influencing human longevity. PMID: 26657933
  14. Our results do not support the notion that TOMM40 poly-T repeat variants have independent effects on Parkinson's disease with dementia and Dementia with Lewy bodies pathology PMID: 26756745
  15. rs2075650 polymorphism in TOMM40 gene may increase the risk of Alzheimer disease. PMID: 26572157
  16. investigate the influence of the TOMM40 intron 6 poly-T variant (rs10524523) on TOMM40 gene expression and cognitive abilities and decline in a cohort of 1613 community-dwelling elderly volunteers PMID: 26742953
  17. rs2075650 at intron region TOMM40 is associated with the A beta-42 levels in CSF. PMID: 26576771
  18. No significant effects of APOE epsilon or TOMM40 523 genotypes on white matter hyperintensities or cerebral microbleed burden were found amongst 624 participants PMID: 26310205
  19. Epilepsy, impaired fine motor function and gastrostomy tube feeding were less common in cerebral palsy children with single nucleotide polymorphisms in the APOE or TOMM40 genes PMID: 25703783
  20. Its variants are related to impairment in allocentric spatial navigation and reduced cortical thickness of specific brain regions among aMCI individuals with (LOAD neutral) APOE epsilon3/epsilon3 genotype. PMID: 25862420
  21. TOMM40 VL polyT repeat, although not influencing disease susceptibility, has a disease-modifying effect on sIBM, which can be enhanced by the APOE genotype epsilon3/epsilon3. PMID: 25670332
  22. This study show genome-wide significant SNP-based associations within three genomic regions 6q16.1 (MIR2113), 14q12 (AKAP6/NPAS3 region) and 19q13.32 (TOMM40/APOE region) with cognition. PMID: 25644384
  23. Elevated levels of TOMM40 and APOE transcripts found in the brains of late-onset Alzheimer's disease-affected individuals compared with unaffected control brains PMID: 24439168
  24. PVRL2, TOMM40 and APOE might be associated with human longevity. PMID: 24924924
  25. The results of this study suggested that previous findings of an association of the TOMM40 short allele with better cognitive performance, independently from the APOE variant status, are pertinent to elderly with diabetes. PMID: 25044051
  26. Two genetic risk factors for late onset Alzheimer's disease are in the apolipoprotein-e and translocase of outer mitochondrial membrane 40 (TOMM40) gene poly-T repeat loci. PMID: 25247594
  27. Influenza A virus protein PB1-F2 translocates into mitochondria via Tom40 channels and impairs innate immunity. PMID: 25140902
  28. The findings of this study consistently lower TOMM40 expression on longitudinal 2-year sampling support its potential role as a diagnostic blood AD biomarker. PMID: 25201778
  29. The present study shows for the first time that TOMM40 rs157581 polymorphism may modulate regional spontaneous brain activity and related to the progression of amnestic mild cognitive impairment. PMID: 24838536
  30. study did not confirm the impact of rs2075650 on advanced AMD risk, indicating that rs2075650 is unlikely a superior marker for APOE/TOMM40 susceptible region with advanced AMD in Han Chinese population. PMID: 25304313
  31. It was discovered that polymorphic variants of TOMM40 rs741780, rs1160985, and rs8106922 are associated with serum triglyceride concentrations. PMID: 25711031
  32. This study development of depression characterized by reduced extraversion, impaired executive function, and decreased positive emotional recall, and reduced top-down cortical control during sad emotion processing. PMID: 24549102
  33. It is an Alzheimer-disease susceptibility gene. PMID: 24508314
  34. in a large community-dwelling sample of older adults, we found no effects of APOE epsilon or TOMM40 523 genotypes on hippocampal volumes. PMID: 24260406
  35. The results of this study suggested that Polymorphism in the TOMM40 gene modifies the risk of developing sporadic inclusion body myositis and the age of onset of symptoms. PMID: 24103330
  36. Blockade of mitochondrial protein import triggers the recruitment of PARK2, by PINK1, to the TOMM machinery. PMID: 24149440
  37. This study associating theTOMM40rs10524523 genotype with clinical characteristics ofpatients carrying thePSEN1M146L mutation belong-ing to the same kindred. PMID: 23792692
  38. TOMM40 intron 6 poly-T length may explain some of the variation in age at onset in PSEN2 familial mouseclick Alzheimer's disease PMID: 23183136
  39. These data provide no evidence to support an association of rs2075650 in TOMM40 with neovascular age-related macular degeneration or polypoidal choroidal vasculopathy. PMID: 24146538
  40. This study demonstrated that the TOMM40 gene does not have an APOE-independent role in the risk of developing LOAD and FTLD. PMID: 23546992
  41. 3 SNPs (rs157580, rs2075650, and rs11556505)were studied in late-onset Alzheimer disease after adjustment for risk factors. Haplotypes derived from SNPs in rs2075650, rs11556505, and rs1160985 were associated with either risk or protective effects. PMID: 23288655
  42. the interaction of alpha-Syn with the mitochondrial protein import machinery, in particular Tom40, might be an upstream event in alpha-Syn-induced neurotoxicity. PMID: 23626796
  43. TOMM40 and APOE common genetic variants are not Parkinson's disease risk factors. PMID: 23522842
  44. TOMM40 gene expression remains significantly lower in Alzheimer's disease patients compared to controls. PMID: 23234877
  45. we report data from two independent Caucasian samples (242 U.S. women and men; 466 Danish men) showing that chronic family stress moderates the association between TOMM40 SNP rs157580 and triglyceride levels. PMID: 23435269
  46. Three SNPs of TOMM40 and APOC1 representating linkage disequilibrium at the 19q13-q13.2 chromosomal region suggest the presence of a different genetic background underlying primary progressive aphasia and the behavioral variant of frontotemporal dementia. PMID: 22710912
  47. Expression levels of TOMM40 protein in mitochondria do not reveal any differences related to the very long or short poly-T variant associated with the risk of late onset Alzheimer's disease. PMID: 22596268
  48. Both TOMM40 and APOE significantly influence age-related memory performance, but they appear to do so independently of each other PMID: 23102119
  49. The results of this study suggested important APOE-independent associations between the TOMM40 '523' polymorphism and specific cognitive domains of memory and executive control that are preferentially affected in early-stage Alzheimer's disease. PMID: 22863908
  50. In chronic hepatitis C, genetic heterogeneity in the APOE/TOMM40 genomic region is significantly associated with variation in serum ApoE and ApoB levels, and also with fibrosis suggesting a pleiotropic attribute of this genomic region. PMID: 22898894

Show More

Hide All

Subcellular Location
Mitochondrion outer membrane; Multi-pass membrane protein.
Protein Families
Tom40 family
Database Links

HGNC: 18001

OMIM: 608061

KEGG: hsa:10452

STRING: 9606.ENSP00000252487

UniGene: Hs.655909

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*