Recombinant Human Mitochondrial import receptor subunit TOM40 homolog(TOMM40)

Code CSB-EP024050HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. O96008
Relevance Channel-forming protein essential for import of protein precursors into mitochondria.By similarity1 Publication
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP024050HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TOMM40.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP024050HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TOMM40.
Storage Buffer Tris-based buffer,50% glycerol
Alias Protein Haymaker Translocase of outer membrane 40 kDa subunit homolog p38.5
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MGNVLAASSPPAGPPPPPAPALVGLPPPPPSPPGFTLPPLGGSLGAGTSTSRSSERTPGAATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQMEGVKLTVNKGLSNHFQVNHTVALSTIGESNYHFGVTYVGTKQLSPTEAFPVLVGDMDNSGSLNAQVIHQLGPGLRSKMAIQTQQSKFVNWQVDGEYRGSDFTAAVTLGNPDVLVGSGILVAHYLQSITPCLALGGELVYHRRPGEEGTVMSLAGKYTLNNWLATVTLGQAGMHATYYHKASDQLQVGVEFEASTRMQDTSVSFGYQLDLPKANLLFKGSVDSNWIVGATLEKKLPPLPLTLALGAFLNHRKNKFQCGFGLTIG
Research Area Tags & Cell Markers
Source E.coli
Gene Names TOMM40
Protein Names Recommended name: Mitochondrial import receptor subunit TOM40 homolog Alternative name(s): Protein Haymaker Translocase of outer membrane 40 kDa subunit homolog p38.5
Expression Region 1-361aa
Tag Info N-terminal GST-tagged
Mol. Weight 64.9kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Channel-forming protein essential for import of protein precursors into mitochondria.
Subcellular Location Mitochondrion outer membrane, Multi-pass membrane protein
Protein Families Tom40 family
Database Links

HGNC: 18001

OMIM: 608061

KEGG: hsa:10452

STRING: 9606.ENSP00000252487

UniGene: Hs.655909

Related Products

TOMM40 Antibodies

TOMM40 Antibodies for Homo sapiens (Human)

TOMM40 Antibodies for Human

TOMM40 Proteins

TOMM40 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.