Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-EP014621HU |
| Product Type | Recombinant Protein |
| Size | US$1726 |
| Uniprot No. | P58340 |
| Relevance | Involved in lineage commitment of primary hemopoietic progenitors by restricting erythroid formation and enhancing myeloid formation. Interferes with erythropoietin-induced erythroid terminal differentiation by preventing cells from exiting the cell cycle through suppression of CDKN1B/p27Kip1 levels. Suppresses RFWD2/COP1 activity via CSN3 which activates p53 and induces cell cycle arrest. Binds DNA and affects the expression of a number of genes so may function as a transcription factor in the nucleus. |
| Image |
|
| Storage Buffer | Tris-based buffer,50% glycerol |
| Alias | Myelodysplasia-myeloid leukemia factor 1 |
| Species | Homo sapiens (Human) |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Sequence | MFRMLNSSFEDDPFFSESILAHRENMRQMIRSFSEPFGRDLLSISDGRGRAHNRRGHNDGEDSLTHTDVSSFQTMDQMVSNMRNYMQKLERNFGQLSVDPNGHSFCSSSVMTYSKIGDEPPKVFQASTQTRRAPGGIKETRKAMRDSDSGLEKMAIGHHIHDRAHVIKKSKNKKTGDEEVNQEFINMNESDAHAFDEEWQSEVLKYKPGRHNLGNTRMRSVGHENPGSRELKRREKPQQSPAIEHGRRSNVLGDKLHIKGSSVKSNKK |
| Research Area | others |
| Source | E.coli |
| Gene Names | MLF1 |
| Protein Names | Recommended name: Myeloid leukemia factor 1 Alternative name(s): Myelodysplasia-myeloid leukemia factor 1 |
| Expression Region | 1-268aa |
| Tag Info | N-terminal GST-tagged |
| Mol. Weight | 57.6kDa |
| Protein Description | Full Length |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Involved in lineage commitment of primary hemopoietic progenitors by restricting erythroid formation and enhancing myeloid formation. Interferes with erythropoietin-induced erythroid terminal differentiation by preventing cells from exiting the cell cycle through suppression of CDKN1B/p27Kip1 levels. Suppresses RFWD2/COP1 activity via CSN3 which activates p53 and induces cell cycle arrest. Binds DNA and affects the expression of a number of genes so may function as a transcription factor in the nucleus. |
| Involvement in disease | A chromosomal aberration involving MLF1 is a cause of myelodysplastic syndrome (MDS). Translocation t(3;5)(q25.1;q34) with NPM1/NPM. |
| Subcellular Location | Cytoplasm, Nucleus |
| Protein Families | MLF family |
| Tissue Specificity | Most abundant in testis, ovary, skeletal muscle, heart, kidney and colon. Low expression in spleen, thymus and peripheral blood leukocytes. |
| Database Links |
HGNC: 7125 OMIM: 601402 KEGG: hsa:4291 UniGene: Hs.85195 |
MLF1 Antibodies for Homo sapiens (Human)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA014621GA01HU | MLF1 Antibody | Human,Mouse,Rat | ELISA,WB,IHC |
| CSB-PA583476 | MLF1 Antibody | Human,Mouse | ELISA,WB |
| CSB-PA010195 | MLF1 Antibody | Human,Mouse | WB,ELISA |
MLF1 Antibodies for Human
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA014621ESR1HU | MLF1 Antibody | Human, Mouse | ELISA, WB, IHC |
| CSB-PA014621ESR2HU | MLF1 Antibody | Human, Mouse | ELISA, WB |
MLF1 Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP014621HU CSB-BP014621HU CSB-MP014621HU |
Recombinant Human Myeloid leukemia factor 1(MLF1) | Yeast Baculovirus Mammalian cell |
Recombinant Mouse Acetylcholine receptor subunit alpha(Chrna1),partial
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Rabbit Tissue factor pathway inhibitor(TFPI)
Express system: E.coli
Species: Oryctolagus cuniculus (Rabbit)
Recombinant Rat Neuroendocrine convertase 2(Pcsk2)
Express system: E.coli
Species: Rattus norvegicus (Rat)
Recombinant Human Cysteine-rich protein 1(CRIP1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Mouse Prostate stem cell antigen(Psca)
Express system: Yeast
Species: Mus musculus (Mouse)
Recombinant Mouse Glutaminyl-peptide cyclotransferase(Qpct)
Express system: E.coli
Species: Mus musculus (Mouse)
