Code | CSB-EP005389HU1 |
Abbreviation | Recombinant Human CHRNA3 protein, partial |
MSDS | |
Size | $224 |
Order now | |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
The recombinant Human CHRNA3 was expressed with the amino acid range of 32-240. The theoretical molecular weight of the CHRNA3 protein is 44.6 kDa. Expression of this CHRNA3 protein is conducted in e.coli. The CHRNA3 gene fragment has been modified by fusing the N-terminal 10xHis-SUMO tag and C-terminal Myc tag, providing convenience in detecting and purifying the recombinant CHRNA3 protein during the following stages.
The human neuronal acetylcholine receptor subunit alpha-3 (CHRNA3) plays a pivotal role in neurotransmission as a component of the nicotinic acetylcholine receptor (nAChR). Activation of nAChRs, including CHRNA3, by acetylcholine or nicotine leads to the influx of ions, particularly sodium and calcium, causing membrane depolarization. This activity is fundamental for synaptic transmission, synaptic plasticity, and various cognitive functions within the central nervous system. Research areas involving CHRNA3 are diverse and include studies related to neurobiology, addiction, and neurodegenerative diseases. Furthermore, genetic variations in CHRNA3 have been associated with nicotine dependence and lung cancer susceptibility, making it a significant target in both neurological and pathological research.There are currently no reviews for this product.
I purchased the extracellular domain of the CHRNA3 gene protein product. I thought I was getting far too much non-specific binding, but after eliminating that as a cause of error, I reviewed the supplied product. An SDS-PAGE gel of the sample at our laboratory showed a protein product of approximately 44Kda; I note that the manufacturer's own in-house SDS-PAGE reveals a similarly sized protein.
The extracellular domain of the CHRNA3 protein is 240 residues long and approximately 28KDa. I feel that there are a number of possibilities to explain these results:
1) The protein I've received is the whole CHRNA3 transcript (including the cytoplasmic and transmembrane domains)
2) The protein I've received is the extracellular domain of the CHRNA3 protein, but has been fused to a different carrier protein for purification purposes
3) The protein I've received is not a transcript of the CHRNA3 gene (perhaps CHRNA1, 5 etc).
Can we double check with the lab to make sure the product supplied was in fact the extracellular domain of the CHRNA3, and if there was any fused proteins on the end, if they can be removed?
Do you have any explanations that would help the customer to understand the size of this protein. The additional 16 KDa is a bit long for His SUMO but is it about right for both tags?
Do you have any feedback that would help them regarding the non-specific binding issue?
MAHHHHHHMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGGSHHHHHHHHHHLVPRGSRT
AAAEQKLISEEDL