Name: Recombinant Human Neuronal acetylcholine receptor subunit alpha-3 (CHRNA3), partial
Brand: CUSABIO
SKU: CSB-EP005389HU1

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

CHRNA3

Uniprot No.

P32297

Research Area

Neuroscience

Alternative Names

ACHA3_HUMAN; AChR; Cholinergic receptor neuronal nicotinic alpha polypeptide 3; Cholinergic receptor nicotinic alpha 3; Cholinergic receptor nicotinic alpha polypeptide 3; CHRNA 3; CHRNA3; LNCR2; MGC104879; NACHRA 3; NACHRA3; Neuronal acetylcholine receptor protein alpha 3 chain precursor; Neuronal acetylcholine receptor subunit alpha 3; Neuronal acetylcholine receptor subunit alpha-3; Neuronal nicotinic acetylcholine receptor alpha 3 subunit; PAOD2

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

32-240aa

Target Protein Sequence

SEAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIGSSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIRRL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

44.6kDa

Protein Length

Extracellular Domain

Tag Info

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The recombinant Human CHRNA3 was expressed with the amino acid range of 32-240. The theoretical molecular weight of the CHRNA3 protein is 44.6 kDa. Expression of this CHRNA3 protein is conducted in e.coli. The CHRNA3 gene fragment has been modified by fusing the N-terminal 10xHis-SUMO tag and C-terminal Myc tag, providing convenience in detecting and purifying the recombinant CHRNA3 protein during the following stages.

The human neuronal acetylcholine receptor subunit alpha-3 (CHRNA3) plays a pivotal role in neurotransmission as a component of the nicotinic acetylcholine receptor (nAChR). Activation of nAChRs, including CHRNA3, by acetylcholine or nicotine leads to the influx of ions, particularly sodium and calcium, causing membrane depolarization. This activity is fundamental for synaptic transmission, synaptic plasticity, and various cognitive functions within the central nervous system. Research areas involving CHRNA3 are diverse and include studies related to neurobiology, addiction, and neurodegenerative diseases. Furthermore, genetic variations in CHRNA3 have been associated with nicotine dependence and lung cancer susceptibility, making it a significant target in both neurological and pathological research.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

I purchased the extracellular domain of the CHRNA3 gene protein product. I thought I was getting far too much non-specific binding, but after eliminating that as a cause of error, I reviewed the supplied product. An SDS-PAGE gel of the sample at our laboratory showed a protein product of approximately 44Kda; I note that the manufacturer's own in-house SDS-PAGE reveals a similarly sized protein.
The extracellular domain of the CHRNA3 protein is 240 residues long and approximately 28KDa. I feel that there are a number of possibilities to explain these results:
1) The protein I've received is the whole CHRNA3 transcript (including the cytoplasmic and transmembrane domains)
2) The protein I've received is the extracellular domain of the CHRNA3 protein, but has been fused to a different carrier protein for purification purposes
3) The protein I've received is not a transcript of the CHRNA3 gene (perhaps CHRNA1, 5 etc).
Can we double check with the lab to make sure the product supplied was in fact the extracellular domain of the CHRNA3, and if there was any fused proteins on the end, if they can be removed?
Do you have any explanations that would help the customer to understand the size of this protein. The additional 16 KDa is a bit long for His SUMO but is it about right for both tags?
Do you have any feedback that would help them regarding the non-specific binding issue?

Very nice to receive your inquiry. For CSB-EP005389HU1, the expression region we provide is 32-240aa, which is complete extracellular domain (http://www.uniprot.org/uniprot/P32297),
and doesn't include cytoplasmic and transmembrane domains.
The molecular weight which you predicted does not include tag. However, CSB-EP005389HU1 is a fusion protein tagged with N-terminal 10xHis-sumo-tag and C-terminal Myc-tag.
The MW of N-terminal 10xHis-sumo-tag and C-terminal Myc-tag is approximately 20kDa, and the actual size is determined by SDS-PAGE.
Therefore, there is no problem the MW the customer detected is 44kDa. Here we provide the complete sequence (including tag sequence + target protein sequence) for the customer's reference.

MAHHHHHHMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGGSHHHHHHHHHHLVPRGSRT

+ Target Protein +

AAAEQKLISEEDL

Target Background

Function

After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.

Gene References into Functions

Frequency of the cholinergic receptor nicotinic alpha 5 (CHRNA5) rs16969968-A allele and cholinergic receptor nicotinic alpha 3 (CHRNA3) rs1051730-T allele were significantly higher in lung cancer than in normal controls. PMID: 29609626
Data indicate potential associations between CHRNA3polymorphisms and schizophrenia susceptibility, and the significant variants identified in our study may be used as genetic biomarkers for schizophrenia susceptibility in Chinese Han population PMID: 29879020
The rs13180 (IREB2), rs16969968 (CHRNA5) and rs1051730 (CHRNA3) were significantly associated with Chronic obstructive pulmonary disease (COPD) in additive model [Padj =0.00001, odds ratio (OR)=0.64; Padj =0.0001, OR=1.41 and Padj =0.0001, OR=1.47]. The C-G haplotype by rs13180 and rs1051730 was a protective factor for COPD in our population (Padj =0.0005, OR=0.61). PMID: 28474623
our results show that a genomic region with functionally related genes, such as the CHRNA5/CHRNA3/CHRNB4 cluster, is under coordinated regulatory control. PMID: 27758088
CHRNA3 genetic risk score was associated with successful smoking cessation in a Chinese rural population. PMID: 28191914
The minor allele increased the risk of COPD when compared to the population at large. Homozygosity for the risk allele was associated in both cohorts with all-cause mortality, with any type of cancer among the COPD patients and with the number of pack-years among the male smokers. PMID: 26751916
The results of this study suggests a pleiotropic role of Chr15q25 CHRNA5-CHRNA3-CHRNB4 gene cluster with complex influences in ADHD, tobacco smoking and cognitive performance. PMID: 27302872
both rs578776 and rs938682 of CHRNA3 were significantly associated with the susceptibility of lung cancer. PMID: 26831765
the association of 3 selected single-nucleotide polymorphisms (CHRNA3 rs1051730, rs6495308, and CHRNA5 rs55853898) with nicotine dependence in an isolated population of Kashubians from Poland, is reported. PMID: 27127891
CHRNA3 rs1051730 (G > A) and AGPHD1 rs8034191 (A > G) were more susceptible to lung cancers than noncarriers. PMID: 27072204
focus on the CHRNA5/A3/B4 gene cluster and its role in nicotine dependence (review) PMID: 25471942
At CHRNA3, allele G of rs3743078 was associated with increased nicotine craving. PMID: 26997181
Our data suggest that gene variance in the CHRNA5-CHRNA3-CHRNB4 cluster is associated with an increased risk of death, incidence of COPD and tobacco-related cancer in smokers. PMID: 26689306
two SNPs (rs6495308 and rs11072768) in CHRNA5-A3-B4 have a indirect effect on lung cancer through smoking behaviors PMID: 26942719
CHRNA3 - candidate gene for Chronic Obstructive Pulmonary Disease identified by Genome-wide association studies. PMID: 26527870
Data suggest that CHRNA5-A3-B4 gene variants do not exhibit a robust association with smoking cessation and are unlikely to be useful for clinically optimizing smoking cessation pharmacotherapy for Caucasian smokers. PMID: 26010901
The positive interaction between heavy smoking and the homozygous mutant CHRNA3 rs6495308 genotype was found to affect the likelihood of hypertension in Chinese male smokers. PMID: 25874685
Four SNPs in the CHRNA3/5 locus are associated with chronic obstructive pulmonary disease risk. [Meta-analysis] PMID: 25051068
CHRNA5-A3-B4 genotype associates with body mass index in never smokers. PMID: 25474695
Of the 2305 SNPs identified in the CHRNA3 gene, 115 were found to be non-synonymous and 12 and 15 nsSNPs were found to be in the 5' and 3' UTRs, respectively. 115 nsSNPs investigated, eight were predicted to be deleterious by both SIFT and PredictSNP servers. PMID: 26002565
Our findings demonstrated that CHRNA3 gene rs6495309 polymorphism might be a risk factor for the development of lung cancer in Chinese. PMID: 25288178
Study provides new evidence that the overexpression of the CHRNA5/A3/B4 region disrupts pyramidal neuronal structure in the hippocampus, and thus affecting the cognitive capacities PMID: 25384568
the haplotype analysis found that the haplotypes "TCAC" and "CTGT," composed of rs938682, rs12914385, rs11637630, and rs2869546, were associated with a 1.79-fold and 501-fold increased lung cancer risk PMID: 25656608
The frequencies of genotype and allele in CHRNA3 (rs8040868) and PHACTR2 (rs9390123) were not significantly different between the NSCLC cases and controls, or between either of the subgroups. PMID: 25399010
GABRR2 and CHRNA3 were found to be differentially expressed after risperidone treatment. These genes may be regulated by antipsychotic use. PMID: 24113126
Suggest no relationship between these smoking-related SNPs in the CHRNA5/A3/B4 gene cluster and psoriasis vulgaris in Chinese Han population. PMID: 25297392
In Mendelian randomisation analyses, there was no strong evidence that the minor allele of rs16969968/rs1051730 was associated with depression, anxiety or psychological distress in current or former smokers. [Meta-analysis] PMID: 25293386
The alpha3beta4* nicotinic ACh receptor subtype mediates physical dependence to morphine PMID: 24750073
High cumulative tobacco consumption is associated with short telomeres observationally, but there is no clear genetic association. PMID: 24906368
Results show that CHRNA3 genotype is associated with decreased lung function and risk of chronic obstructive pulmonary disease. among ever-smokers, whereas this was not the case for CYP3A5*3. PMID: 24535486
Increased expression of NeuroD1 subsequently leads to regulation of expression and function of the nicotinic acetylcholine receptor subunit cluster of alpha3, alpha5, and beta4. PMID: 24719457
CHRNA3 polymorphism functions as a genetic modifier of the risk of developing lung ADC in the Chinese population, particularly in nonsmoking females. PMID: 24686516
The minor alleles of two polymorphisms (rs578776 and rs3743078) in the CHRNA3 gene are associated with an increased risk of tobacco smoking only among patients with ADHD. PMID: 24375168
Elucidation of the signaling events elicited upon agonist binding to corneal mAChRs and nAChRs will be crucial for understanding the mechanisms of ACh signaling in CECs, which has salient clinical implications. PMID: 25270189
rs1051730 polymorphism may modify susceptibility to lung cancer via a smoking-independent manner among Chinese Han population. PMID: 24337855
Rare missense variants in CHRNB3 and CHRNA3 are associated with risk of alcohol and cocaine dependence. PMID: 24057674
Genetic variants in the CHRNA5-A3-B4 gene cluster alter nicotine intake and body mass index in a population of Alaska Native people, who have a distinct haplotype structure, smoking behaviors and prevalence of obesity. PMID: 23692359
Investigated associations between neuroticism and 13 SNPs in the CHRNA5 and CHRNA3 genes in young adult Mexican American men and women. PMID: 24588897
Women with the variant AA genotype of CHRNA3 rs578775 were at significantly decreased risk of heavy smoking. PMID: 21810735
study identified an association between a nicotinic acetylcholine receptor a3 subunit variant (rs578776)and reward-related neural response in a large cohort of healthy non-smoking adolescents. PMID: 23689675
Genetic variations in CHRNA3 are associated with COPD in the Korean population. PMID: 23207642
Genetic variation in nicotinic receptor gene CHRNA3 might be an important connecting link between early attentional processes and smoking behavior. PMID: 23604333
CHRNA3 gene rs3743073G variant genotype significantly increased lung cancer risk, especially in male smokers over the age of 60. PMID: 23023782
Rare genetic variation in the CHRNA5-A3-B4 gene cluster contributes modestly to the level of response to alcohol. PMID: 23458267
CHRNA5-A3-B4 rs667282 TT/TG genotypes were associated with significantly increased risk of esophageal squamous cell carcinoma. PMID: 23844051
CHRNA3 polymorphism was associated with pack-year of smoking in chronic obstructive pulmonary disease Chinese Han patients PMID: 22914670
Our findings uncover a novel mechanism of nicotine-induced alpha3beta4 nAChR upregulation that may be relevant also for other nAChR subtypes. PMID: 23884938
silencing alpha3 nAChR mRNA might enhance the effect of Abeta25-35 on cell apoptosis by increasing the levels of p38 protein and bax mRNA and decreasing the level of bcl-2 mRNA, which may play a role in the pathogenesis of Alzheimer's disease PMID: 23710919
SNP rs1051730 associated with smoking and body mass index PMID: 23729684
we evaluate the utility of genetic variants in CHRNA3 for smoking as a risk factor in low birth weight PMID: 23701534

Hide All

Subcellular Location

Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.

Protein Families

Ligand-gated ion channel (TC 1.A.9) family, Acetylcholine receptor (TC 1.A.9.1) subfamily, Alpha-3/CHRNA3 sub-subfamily

Database Links

HGNC: 1957

OMIM: 118503

KEGG: hsa:1136

STRING: 9606.ENSP00000315602

UniGene: Hs.89605

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address