Recombinant Human Neutrophil defensin 1(DEFA1)

In Stock
Code CSB-EP006652HU
Product Type Recombinant Protein
Size US$2466
Uniprot No. P59665
Lead Time 3-7 business days
Relevance Defensin 1 and defensin 2 have antibacterial, fungicide and antiviral activities. Has antimicrobial activity against Gram-negative and Gram-positive bacteria. Defensins are thought to kill microbes by permeabilizing their plasma membrane.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Defensin, alpha 1HNP-1
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence DIPEVVVSLAWDESLAPKHPGSRKNMACYCRIPACIAGERRYGTCIYQGRLWAFCC
Source E.coli
Gene Names DEFA1
Protein Names Recommended name: Neutrophil defensin 1Alternative name(s): Defensin, alpha 1 HNP-1 Short name= HP-1 Short name= HP1Cleaved into the following 2 chains: 1. HP 1-56 2. Neutrophil defensin 2Alternative name(s): HNP-2 Short n
Expression Region 1-94aa
Tag Info N-terminal GST-tagged
Mol. Weight 37.2 kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Defensin 1 and defensin 2 have antibacterial, fungicide and antiviral activities. Has antimicrobial activity against Gram-negative and Gram-positive bacteria. Defensins are thought to kill microbes by permeabilizing their plasma membrane.
Subcellular Location Secreted
Protein Families Alpha-defensin family
Database Links

HGNC: 2761

OMIM: 125220

KEGG: hsa:1667

STRING: 9606.ENSP00000372136

UniGene: Hs.380781

Related Products

DEFA1 Antibodies

DEFA1 Antibodies for Homo sapiens (Human)

DEFA1 Antibodies for Human

DEFA1 Proteins

DEFA1 Proteins for Homo sapiens (Human)

DEFA1 ELISA Kit

DEFA1 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.