Recombinant Human Neutrophil defensin 1 (DEFA1)

In Stock
Code CSB-EP006652HU
Abbreviation Recombinant Human DEFA1 protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
DEFA1
Uniprot No.
Alternative Names
alpha 1; DEF1; DEF1_HUMAN; DEFA1; DEFA1B; DEFA2; Defensin 1; Defensin; Defensin; alpha 1; Defensin; alpha 1; myeloid related sequence; Defensin; alpha 2; HNP-1; HNP-2; HNP1; HP-1; HP-2; HP1; HP2; MRS; Myeloid related sequence; Neutrophil defensin 1; Neutrophil defensin 2
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-94aa
Target Protein Sequence
MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMACYCRIPACIAGERRYGTCIYQGRLWAFCC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
37.2kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The expression region of this recombinant Human DEFA1 covers amino acids 1-94. This DEFA1 protein is theoretically predicted to have a molecular weight of 37.2 kDa. Expression of this DEFA1 protein is conducted in e.coli. The DEFA1 gene fragment has been modified by fusing the N-terminal GST tag, providing convenience in detecting and purifying the recombinant DEFA1 protein during the following stages.

Neutrophil defensin 1 (DEFA1) is a member of the defensin family, small cationic peptides with antimicrobial properties. DEFA1 is primarily produced by neutrophils, a type of white blood cell, and serves as part of the innate immune system's defense against microbial infections. This antimicrobial peptide exerts its function by disrupting the microbial cell membrane, leading to cell death. Beyond its antimicrobial role, DEFA1 has been implicated in various immune responses and inflammatory processes. Research areas related to DEFA1 include investigations into its role in host-pathogen interactions, immune regulation, and potential therapeutic applications in combating infectious diseases. Understanding the functions of DEFA1 contributes to insights into the immune system's defense mechanisms.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Defensin 1 and defensin 2 have antibacterial, fungicide and antiviral activities. Has antimicrobial activity against Gram-negative and Gram-positive bacteria. Defensins are thought to kill microbes by permeabilizing their plasma membrane.
Gene References into Functions
  1. lower DEFA1/DEFA3 copy number (CNV < 7) is associated with higher susceptibility to hospital-acquired infections (HAIs) in critically ill patients, indicating that host genetic factors are involved in the development of HAIs PMID: 29950924
  2. Human Neutrophil Peptide 1 directly binds and neutralizes Exotoxin A of Pseudomonas aeruginosa. PMID: 29738776
  3. Pretreatment of component b with human alpha-defensin-1 prior to addition of component a of Clostridium perfringens iota toxin prevented intoxication implicating that alpha-defensin-1 interacts with the toxin b component to prevent the formation of biologically active iota toxin on cells. PMID: 29635426
  4. DEFA1, DEFA3, and PPBP expression was significantly increased in hyperlipidemia and coronary heart disease patients compared with controls. PMID: 28420383
  5. HNP1 upregulation of cytokine expression in pDCs was inhibited by blockade of NF-kappaB activation or knockdown of IRF1, demonstrating the importance of these two signaling events in HNP1-induced pDC activation. PMID: 27031443
  6. these results demonstrate that HNPs1-3 may be potent inhibitors of ADAMTS13 activity, likely by binding to the central A2 domain of VWF and physically blocking ADAMTS13 binding. PMID: 27207796
  7. Increased alpha-defensin expression is associated with risk of coronary heart disease in hyperlipidemia patients. PMID: 27430968
  8. Levels in sera and CSF were elevated in Alzheimer disease patients compared with controls. PMID: 27082275
  9. the decreased HNP-1 production in the polymorphonuclear phagocytes form elderly individuals might have an important participation in the increased susceptibility to infectious diseases. PMID: 26323500
  10. Increased levels of neutrophil defensin 1, apolipoprotein E, clusterin, and zinc-alpha-2-glycoprotein are present in carotid atherosclerotic plaque secretomes. PMID: 26795031
  11. HNP1 functions as a "molecular brake" on macrophage-driven inflammation, ensuring both pathogen clearance and the resolution of inflammation with minimal bystander tissue damage. PMID: 27044108
  12. HP1 binding to the chromosomal passenger complex becomes particularly important when Aurora B phosphorylates kinetochore targets to eliminate erroneous microtubule attachments PMID: 26954544
  13. data demonstrate that HNP-1 induces IL-8 production not only through P2Y6, but also through additional P2 receptors via an ERK1/2-dependent mechanism in intestinal epithelial cells. PMID: 25816245
  14. Results showed that NO and NaNO2 can be considered as factors regulating the chemoattractant properties of defensin HNP1 in neutrophils PMID: 25772994
  15. Overexpression of DEFA1 retained independent prognostic significance for B-ALL outcome. PMID: 25802479
  16. The expression of alpha-defensins 1, 2 and 3 is up-regulated in hypercholesteremia. PMID: 25300997
  17. Defensins promote the differentiation into activated CD91(bright) dendritic cells. PMID: 25351513
  18. Elevated DEFA1 levels in diabetes are independent of DEFA1 copy numbers. PMID: 25083086
  19. The AD-1 assay offers another test with high sensitivity and specificity for diagnosing a prosthetic joint infection. PMID: 25256621
  20. The concentrations of LL37, alpha-1, beta-1 and beta-2 defensins were determined by ELISA. Serum AMPs did not change during attacks and did not correlate with acute phase reactants. PMID: 24747281
  21. DEFA1 encodes an antibacterial peptide that is bacteriocidal against S. aureus, E. coli, and P. aeruginosa. PMID: 2997278
  22. Side chain hydrophobicity is the critical factor that determines HNP1 protein binding potential. PMID: 24236072
  23. A decrease in salivary HNP 1-3 levels might be a biological factor for predisposition to oral ulcers in patients with Behcet disease and oral infection in healthy patients. PMID: 22861387
  24. HNP-1 enhances hepatic fibrosis in fatty liver by inducing hepatic stellate cell proliferation. PMID: 23682724
  25. -defensin 1 increases EFS-induced contractions of rat detrusor muscles PMID: 23542712
  26. sub-inhibitory doses of HNP-1 potently enhance the activity of a number of anti-gp41 antibodies and peptide inhibitors PMID: 23785290
  27. Human defensin alpha-1 is an innate immune molecule that is secreted by HCT116 cells in response to Trypanosoma cruzi infection, inhibits Trypanosoma cruzi motility, and plays an important role in reducing cellular infection. PMID: 23980110
  28. Results indicate that the gene expression of DEFA 1/3 and 4 was significantly increased in all tumours - except for a significant decrease of DEFA 4 gene expression in pleomorphic adenomas. PMID: 23050799
  29. This study suggests that HNPs 1-3 promote tumor invasion and are potential indicators of disease progression in patients with bladder cancer. PMID: 23011762
  30. Invariant gly residue is important for alpha-defensin folding, dimerization PMID: 22496447
  31. alpha-Defensin (DEFA1) was the most differentially overexpressed gene in this sample and may be related to the onset of Bell's palsy and Ramsay Hunt Syndrome. PMID: 22737966
  32. expressional level of HNPs 1,2 and 3 were significantly higher and their distributions overlapped in cancerous tissues of gastric cancer patients PMID: 22297599
  33. Dimerization contributes to some but not all of the activities of HNP1. PMID: 22270360
  34. A high DEFA1 gene CN was significantly associated with intestinal involvement in BD patients. PMID: 22219625
  35. Directly isolated dendritic cells secrete alpha-defensins 1-3; E2 inhibits this secretion. Same trend is observed in myeloid dendritic cells isolated from pregnant women in their first trimester (low plasma E2) and third trimester (high plasma E2). PMID: 21861873
  36. Increased levels of human neutrophil peptides 1, 2, and 3 in peritoneal fluid of patients with endometriosis: association with neutrophils, T cells and IL-8. PMID: 21831449
  37. Human granulocyte precursors transfected with siRNA against serglycin displayed reduced capability to retain fully processed HNP-1. PMID: 21849484
  38. HNP1-3 concentrations in patients with multidrug-resistant tuberculosis were significantly lower than in drug-susceptible pulmonary TB and healthy controls PMID: 21333105
  39. Changes in the expression pattern of DEFA 1/3 seem to be involved in the development of gingival irritation fibromas, whereas chronic inflammation might be of less importance. PMID: 21187770
  40. alpha-defensins 1-3 in T cells from patients with SJS/TEN may be involved in the etiopathology of these life-threatening diseases induced by medications. PMID: 20880148
  41. defensin-alpha(1)is a biologically active peptide exhibiting a dose-dependent trypanocidal effect in vitro against trypomastigotes and amastigotes of Trypanosoma cruzi line Tulahuen PMID: 21165432
  42. HNP-1 (alpha), HBD-2 (beta) and RTD-1 (theta) have anti-HIV-1 activity, but different mechanisms of action PMID: 20305815
  43. HNP-1 mainly enhanced the expression of IL-8 in epithelial cells, whereas it enhanced transforming growth factor-beta and vascular endothelial growth factor expressions in lung fibroblasts. PMID: 20715983
  44. Our report of DEFA1-3 expression by human omental adipocytes adds to the role of adipocytes in the primary defense against bacterial infection. PMID: 20424487
  45. Data show that high production of alpha-defensins1-3 by immature DCs appears as a host protective factor against progression of HIV-1 infection, suggesting potential diagnostic, therapeutic and preventive implications. PMID: 20195543
  46. The total amount of gingival crevicular fluid human neutrophil peptides 1 and 2 were not different among periodontitis, gingivitis, and health control groups; there was no correlation with clinical periodontal parameters. PMID: 20151808
  47. HNP1 binds to the cell wall precursor lipid II and reduction of lipid II levels in the bacterial membrane significantly reduces bacterial killing. PMID: 20214904
  48. Combining the distance constraints from the 3d experiment and the chemical-shift-derived torsion angles, we obtained a de novo high-resolution NMR structure of HNP-1 PMID: 19963419
  49. HNP1 mediates host immune responses to tumors in situ through the recruitment and subsequent activation of immature dendritic cells PMID: 19861439
  50. The solid-state NMR structure of HNP-1 has close similarity to the crystal structures of the HNP family, with the exception of the loop region between the first and second beta-strands. PMID: 20097206

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Alpha-defensin family
Database Links

HGNC: 2761

OMIM: 125220

KEGG: hsa:1667

STRING: 9606.ENSP00000372136

UniGene: Hs.380781

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*