Recombinant Human Neutrophil defensin 1(DEFA1)

In Stock
Code CSB-EP006652HU
Size US$2466
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names DEFA1
Uniprot No. P59665
Alternative Names alpha 1; DEF1; DEF1_HUMAN; DEFA1; DEFA1B; DEFA2; Defensin 1; Defensin; Defensin; alpha 1; Defensin; alpha 1; myeloid related sequence; Defensin; alpha 2; HNP-1; HNP-2; HNP1; HP-1; HP-2; HP1; HP2; MRS; Myeloid related sequence; Neutrophil defensin 1; Neutrophil defensin 2
Species Homo sapiens (Human)
Source E.coli
Expression Region 1-94aa
Target Protein Sequence DIPEVVVSLAWDESLAPKHPGSRKNMACYCRIPACIAGERRYGTCIYQGRLWAFCC
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 37.2 kDa
Protein Length Full Length
Tag Info N-terminal GST-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Defensin 1 and defensin 2 have antibacterial, fungicide and antiviral activities. Has antimicrobial activity against Gram-negative and Gram-positive bacteria. Defensins are thought to kill microbes by permeabilizing their plasma membrane.
Gene References into Functions
  1. lower DEFA1/DEFA3 copy number (CNV < 7) is associated with higher susceptibility to hospital-acquired infections (HAIs) in critically ill patients, indicating that host genetic factors are involved in the development of HAIs PMID: 29950924
  2. Human Neutrophil Peptide 1 directly binds and neutralizes Exotoxin A of Pseudomonas aeruginosa. PMID: 29738776
  3. Pretreatment of component b with human alpha-defensin-1 prior to addition of component a of Clostridium perfringens iota toxin prevented intoxication implicating that alpha-defensin-1 interacts with the toxin b component to prevent the formation of biologically active iota toxin on cells. PMID: 29635426
  4. DEFA1, DEFA3, and PPBP expression was significantly increased in hyperlipidemia and coronary heart disease patients compared with controls. PMID: 28420383
  5. HNP1 upregulation of cytokine expression in pDCs was inhibited by blockade of NF-kappaB activation or knockdown of IRF1, demonstrating the importance of these two signaling events in HNP1-induced pDC activation. PMID: 27031443
  6. these results demonstrate that HNPs1-3 may be potent inhibitors of ADAMTS13 activity, likely by binding to the central A2 domain of VWF and physically blocking ADAMTS13 binding. PMID: 27207796
  7. Increased alpha-defensin expression is associated with risk of coronary heart disease in hyperlipidemia patients. PMID: 27430968
  8. Levels in sera and CSF were elevated in Alzheimer disease patients compared with controls. PMID: 27082275
  9. the decreased HNP-1 production in the polymorphonuclear phagocytes form elderly individuals might have an important participation in the increased susceptibility to infectious diseases. PMID: 26323500
  10. Increased levels of neutrophil defensin 1, apolipoprotein E, clusterin, and zinc-alpha-2-glycoprotein are present in carotid atherosclerotic plaque secretomes. PMID: 26795031
  11. HNP1 functions as a "molecular brake" on macrophage-driven inflammation, ensuring both pathogen clearance and the resolution of inflammation with minimal bystander tissue damage. PMID: 27044108
  12. HP1 binding to the chromosomal passenger complex becomes particularly important when Aurora B phosphorylates kinetochore targets to eliminate erroneous microtubule attachments PMID: 26954544
  13. data demonstrate that HNP-1 induces IL-8 production not only through P2Y6, but also through additional P2 receptors via an ERK1/2-dependent mechanism in intestinal epithelial cells. PMID: 25816245
  14. Results showed that NO and NaNO2 can be considered as factors regulating the chemoattractant properties of defensin HNP1 in neutrophils PMID: 25772994
  15. Overexpression of DEFA1 retained independent prognostic significance for B-ALL outcome. PMID: 25802479
  16. The expression of alpha-defensins 1, 2 and 3 is up-regulated in hypercholesteremia. PMID: 25300997
  17. Defensins promote the differentiation into activated CD91(bright) dendritic cells. PMID: 25351513
  18. Elevated DEFA1 levels in diabetes are independent of DEFA1 copy numbers. PMID: 25083086
  19. The AD-1 assay offers another test with high sensitivity and specificity for diagnosing a prosthetic joint infection. PMID: 25256621
  20. The concentrations of LL37, alpha-1, beta-1 and beta-2 defensins were determined by ELISA. Serum AMPs did not change during attacks and did not correlate with acute phase reactants. PMID: 24747281
  21. DEFA1 encodes an antibacterial peptide that is bacteriocidal against S. aureus, E. coli, and P. aeruginosa. PMID: 2997278
  22. Side chain hydrophobicity is the critical factor that determines HNP1 protein binding potential. PMID: 24236072
  23. A decrease in salivary HNP 1-3 levels might be a biological factor for predisposition to oral ulcers in patients with Behcet disease and oral infection in healthy patients. PMID: 22861387
  24. HNP-1 enhances hepatic fibrosis in fatty liver by inducing hepatic stellate cell proliferation. PMID: 23682724
  25. -defensin 1 increases EFS-induced contractions of rat detrusor muscles PMID: 23542712
  26. sub-inhibitory doses of HNP-1 potently enhance the activity of a number of anti-gp41 antibodies and peptide inhibitors PMID: 23785290
  27. Human defensin alpha-1 is an innate immune molecule that is secreted by HCT116 cells in response to Trypanosoma cruzi infection, inhibits Trypanosoma cruzi motility, and plays an important role in reducing cellular infection. PMID: 23980110
  28. Results indicate that the gene expression of DEFA 1/3 and 4 was significantly increased in all tumours - except for a significant decrease of DEFA 4 gene expression in pleomorphic adenomas. PMID: 23050799
  29. This study suggests that HNPs 1-3 promote tumor invasion and are potential indicators of disease progression in patients with bladder cancer. PMID: 23011762
  30. Invariant gly residue is important for alpha-defensin folding, dimerization PMID: 22496447
  31. alpha-Defensin (DEFA1) was the most differentially overexpressed gene in this sample and may be related to the onset of Bell's palsy and Ramsay Hunt Syndrome. PMID: 22737966
  32. expressional level of HNPs 1,2 and 3 were significantly higher and their distributions overlapped in cancerous tissues of gastric cancer patients PMID: 22297599
  33. Dimerization contributes to some but not all of the activities of HNP1. PMID: 22270360
  34. A high DEFA1 gene CN was significantly associated with intestinal involvement in BD patients. PMID: 22219625
  35. Directly isolated dendritic cells secrete alpha-defensins 1-3; E2 inhibits this secretion. Same trend is observed in myeloid dendritic cells isolated from pregnant women in their first trimester (low plasma E2) and third trimester (high plasma E2). PMID: 21861873
  36. Increased levels of human neutrophil peptides 1, 2, and 3 in peritoneal fluid of patients with endometriosis: association with neutrophils, T cells and IL-8. PMID: 21831449
  37. Human granulocyte precursors transfected with siRNA against serglycin displayed reduced capability to retain fully processed HNP-1. PMID: 21849484
  38. HNP1-3 concentrations in patients with multidrug-resistant tuberculosis were significantly lower than in drug-susceptible pulmonary TB and healthy controls PMID: 21333105
  39. Changes in the expression pattern of DEFA 1/3 seem to be involved in the development of gingival irritation fibromas, whereas chronic inflammation might be of less importance. PMID: 21187770
  40. alpha-defensins 1-3 in T cells from patients with SJS/TEN may be involved in the etiopathology of these life-threatening diseases induced by medications. PMID: 20880148
  41. defensin-alpha(1)is a biologically active peptide exhibiting a dose-dependent trypanocidal effect in vitro against trypomastigotes and amastigotes of Trypanosoma cruzi line Tulahuen PMID: 21165432
  42. HNP-1 (alpha), HBD-2 (beta) and RTD-1 (theta) have anti-HIV-1 activity, but different mechanisms of action PMID: 20305815
  43. HNP-1 mainly enhanced the expression of IL-8 in epithelial cells, whereas it enhanced transforming growth factor-beta and vascular endothelial growth factor expressions in lung fibroblasts. PMID: 20715983
  44. Our report of DEFA1-3 expression by human omental adipocytes adds to the role of adipocytes in the primary defense against bacterial infection. PMID: 20424487
  45. Data show that high production of alpha-defensins1-3 by immature DCs appears as a host protective factor against progression of HIV-1 infection, suggesting potential diagnostic, therapeutic and preventive implications. PMID: 20195543
  46. The total amount of gingival crevicular fluid human neutrophil peptides 1 and 2 were not different among periodontitis, gingivitis, and health control groups; there was no correlation with clinical periodontal parameters. PMID: 20151808
  47. HNP1 binds to the cell wall precursor lipid II and reduction of lipid II levels in the bacterial membrane significantly reduces bacterial killing. PMID: 20214904
  48. Combining the distance constraints from the 3d experiment and the chemical-shift-derived torsion angles, we obtained a de novo high-resolution NMR structure of HNP-1 PMID: 19963419
  49. HNP1 mediates host immune responses to tumors in situ through the recruitment and subsequent activation of immature dendritic cells PMID: 19861439
  50. The solid-state NMR structure of HNP-1 has close similarity to the crystal structures of the HNP family, with the exception of the loop region between the first and second beta-strands. PMID: 20097206
  51. A population of immature dysplastic granulocytes contributes to the chronic myelomonocytic leukemia phenotype through production of alpha-defensins HNP1-3 that suppress the differentiation capabilities of monocytes. PMID: 19864642
  52. Data show that ADP-ribosylation of HNP-1 in vitro generated a product with ADP-ribose on arginine 24, and ornithine replacing arginine at position 14. PMID: 19897717
  53. ADP ribosylation 1 regulates its biological properties PMID: 12060767
  54. increased levels in fetal disease, premature rupture of membranes, and preterm labor PMID: 12710851
  55. results suggest that alpha-defensin-1 inhibits HIV-1 infection following viral entry but that alpha-defensins 1 to 3 are not responsible for the HIV-1 transcriptional inhibition by CAF. PMID: 12767998
  56. Characterization of the molecular basis for the recognition between the 45-residue pro-peptide and the C-terminal functional domain of HNP-1. PMID: 12823617
  57. These results indicate that neutrophil defensins HNP-1, -2, and -3 increase epithelial wound repair in vitro, which involves migration and proliferation, mucin production, epidermal growth factor receptor activation and downstream signaling pathways. PMID: 12871849
  58. BPI and HNP1-3 are accumulated in the synovial cavity of patients with rheumatoid arthritis PMID: 12913926
  59. HNP-1 is a potentially important regulator of neovascularizaiton, suggesting a new link between inflammation and angiogenesis. PMID: 15208269
  60. Data demonstrate that, in the absence of serum, alpha-defensin-1 may act directly on the virus, but, in the presence of serum, its effects are on the cell, where it inhibits HIV-1 replication. PMID: 15719067
  61. HNP-1 inhibited cleavage of a mitogen-activated protein kinase kinase and restored impaired mitogen-activated protein kinase signaling in anthrax-lethal-toxin-treated macrophages. PMID: 15772169
  62. expression levels in human white blood cells showed clear correlation between relative proportions of DEFA1:DEFA3 mRNA and corresponding gene numbers. However, there was no relationship between total (DEFA1+DEFA3) mRNA levels and total gene copy number PMID: 15944200
  63. the Arg5-Glu13 salt bridge in alpha-defensin is conserved for defensin in vivo stability PMID: 16246847
  64. Subjects were genotyped for alpha-defensin-1/alpha-defensin-3, and four beta-defensin-1 polymorphisms. These polymorphisms may not be important in abnormally rapid lung function decline or susceptibility to lower respiratory infections. PMID: 16700921
  65. The myeloid def1 promoter contains a weak TATA box plus one requisite and one helper site that specifically recruit GA-binding protein (def1-binding protein) and PU.1 into an active transcription site. PMID: 16709851
  66. HNP1 (human neutrophil protein 1) inhibited diphtheria toxin (DT)- or Pseudomonas exotoxin A (ETA)-mediated ADP-ribosylation of eEF2 (eukaryotic elongation factor 2) and protected HeLa cells against DT- or ETA-induced cell death. PMID: 16817779
  67. data suggest that alpha-defensins within lymphoid tissue are expressed by granulocytes and are prevalent in HIV-1-seronegative individuals with inflammatory processes as well as HIV-1-infected individuals PMID: 16837860
  68. HNP-1 interacts with both C1q and MBL efficiently resulting in inhibition of both the classical and the lectin pathway of complement. PMID: 17448537
  69. Alpha-defensins 1-3 levels are nonspecifically elevated in stools from patients with colorectal neoplasia and likely originate from white blood cells. Alpha-defensins 1-3 in stool might serve as markers of inflammatory bowel conditions. PMID: 17531545
  70. HNP-1 controls afferent discharge and modulates effects of glutamine in vestibular end organs of frog. PMID: 17606342
  71. human defensin alpha-1 causes membrane pore formation in a human parasite, leading to trypanosome destruction. PMID: 17635867
  72. Human alpha-defensin-1 inhibited influenza virus replication and viral protein synthesis. PMID: 17703413
  73. Serum alpha-defensin (-1, -2 and -3) concentrations are increased in type 1 diabetic patients with diabetic nephropathy. PMID: 18003664
  74. We have found that the alpha-defensins HNP1 and HD5 have potent antiadenoviral activity. These molecules block HAdV infection by stabilizing the virus capsid, thereby preventing uncoating and virus-mediated endosome penetration. PMID: 18191790
  75. These results support the hypothesis that HNPs can suppress hepatic glucose production through an intracellular mechanism distinct from the classical insulin signaling pathway. PMID: 18347011
  76. Clostridium difficile toxin B interacts with high affinity with HNP-1 which may provide a defense mechanism against clostridial glucosylating cytotoxins. PMID: 18435932
  77. There are increased levels of human neutrophil alpha-defensins (alpha-defensin-1, -2, and -3) in chronic venous leg ulcers. PMID: 18472248
  78. The authors analyzed the sensitivities of different pneumococcal strains to HNP1-3 and found that encapsulated strains are efficiently killed at physiological concentrations (7.5 microg/ml). PMID: 18474654
  79. results indicate that intracellularly expressed HNP1 induces tumor cell apoptosis, which inhibits tumor growth PMID: 18566229
  80. hydrophobic forces have a dominant role in mediating the interactions between HNP1 and its propeptide--a finding largely contrasting the commonly held view that the interactions are of an electrostatic nature. PMID: 18616948
  81. In African Americans, midpregnancy human neutrophil peptide 1-3 levels were more informative to preterm delivery risk than was bacterial vaginosis PMID: 18757648
  82. alpha-defensin human neutrophil protein 1 (HNP1) and human alpha-defensin 5 (HD5) inhibit BKV infection by targeting an early event in the viral lifecycle. PMID: 18782756
  83. Upregulation of HNP1 is associated with colorectal adenomas and carcinomas. PMID: 18957723
  84. Salivary HNP1, HNP-2 concentrations increased following exercise PMID: 19263072
  85. HNP-1 and HBD-1 promoted the up-regulation of CD91 on the DC surface PMID: 19477909
  86. HNP1 and HD5 kill E. coli by a process that is mechanistically distinct from their actions that kill S. aureus; and chiral molecular recognition is not a stringent prerequisite for other functions of the defensins PMID: 19640840

Show More

Hide All

Subcellular Location Secreted
Protein Families Alpha-defensin family
Database Links

HGNC: 2761

OMIM: 125220

KEGG: hsa:1667

STRING: 9606.ENSP00000372136

UniGene: Hs.380781

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved. 鄂ICP备15011166号-1