Recombinant Human Nicotinamide N-methyltransferase (NNMT)

In Stock
Code CSB-EP015906HU
Abbreviation Recombinant Human NNMT protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
EC 2.1.1.1; Nicotinamide N methyltransferase; Nicotinamide N-methyltransferase; NNMT; NNMT_HUMAN
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-264aa
Target Protein Sequence
MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLSRPL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
56.6kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalyzes the N-methylation of nicotinamide using the universal methyl donor S-adenosyl-L-methionine to form N1-methylnicotinamide and S-adenosyl-L-homocysteine, a predominant nicotinamide/vitamin B3 clearance pathway. Plays a central role in regulating cellular methylation potential, by consuming S-adenosyl-L-methionine and limiting its availability for other methyltransferases. Actively mediates genome-wide epigenetic and transcriptional changes through hypomethylation of repressive chromatin marks, such as H3K27me3. In a developmental context, contributes to low levels of the repressive histone marks that characterize pluripotent embryonic stem cell pre-implantation state. Acts as a metabolic regulator primarily on white adipose tissue energy expenditure as well as hepatic gluconeogenesis and cholesterol biosynthesis. In white adipocytes, regulates polyamine flux by consuming S-adenosyl-L-methionine which provides for propylamine group in polyamine biosynthesis, whereas by consuming nicotinamide controls NAD(+) levels through the salvage pathway. Via its product N1-methylnicotinamide regulates protein acetylation in hepatocytes, by repressing the ubiquitination and increasing the stability of SIRT1 deacetylase. Can also N-methylate other pyridines structurally related to nicotinamide and play a role in xenobiotic detoxification.
Gene References into Functions
  1. TGF-beta1 is significantly overexpressed in tumor tissue samples of clear cell Renal cell carcinoma patients. TGF-beta1 up-regulation could be responsible for the high levels of NNMT observed in clear cell Renal cell carcinoma tissues. PMID: 29974846
  2. Our data indicate that NNMT is a promising biomarker that could be used to support the early and noninvasive diagnosis of Bladder cancer PMID: 29148015
  3. Here we explored the association between NNMT gene polymorphisms and obesity. The subjects were recruited from male Chinese Han college student... the variation of the tagSNP, rs10891644, is significantly associated with obesity and the GT carriers are the susceptible population PMID: 29075643
  4. our results suggest that the ZEB1/NNMT signaling axis induces phenotypic and metabolic plasticity, as well as mesenchymal gene expression in ovarian cancer cells upon chronic glucose deprivation PMID: 28412735
  5. We demonstrate that NNMT outcompetes leucine carboxyl methyl transferase 1 (LCMT1) for methyl transfer from principal methyl donor SAM in biological systems. Inhibiting NNMT increased the availability of methyl groups for LCMT1 to methylate PP2A, resulting in the inhibition of oncogenic serine/threonine kinases (STK). PMID: 27810903
  6. High expression level of NNMT is associated with pancreatic cancer. PMID: 26942567
  7. This finding, for the first time, suggests the involvement of the NNMT gene rs694539 variant in the etiology of epilepsy. PMID: 26215836
  8. this study provides the first demonstration that NNMT plays a role in the resistance to 5-fluorouracil in colorectal cancer cells PMID: 27323852
  9. We suggest that lymph node metastatic adenoid cystic carcinoma (AdCC) cells acquire cancer stem cell features involving the up-regulation of NNMT and the loss of gap junction protein alpha-1, leading to epithelial-mesenchymal transition and consequent AdCC metastasis. PMID: 29277772
  10. Progression of pulmonary hypertension is associated with the activation of the NNMT-1-methylnicotinamide pathway. PMID: 27581040
  11. no SNP in NNMT is significantly associated with performance in 50-m run but rs2256292 is significantly associated with performance in 1000-m run in male Chinese college students PMID: 27900880
  12. These findings indicate that the repression of NNMT may underlie nickel-induced H3K9 dimethylation by altering the cellular SAM/SAH ratio. PMID: 28420001
  13. NNMT expression is significantly upregulated in human masticatory mucosa during wound healing PMID: 28005267
  14. The results show that a SNP (rs1941404) in NNMT is significantly associated with hyperlipidemia, and the influence of rs1941404 variation on the resting energy expenditure may be the possible mechanism for rs1941404 variation to induce hyperlipidemia. PMID: 27999813
  15. NNMT gene rs694539 variant is a genetic risk factor for migraine in women. PMID: 27726107
  16. There were no associations between MTHFR C677T, NNMT rs694539 AG/AA polymorphisms and conotruncal heart disease. PMID: 25547204
  17. Data show that nicotinamide N-methyltransferase (NNMT) and the metabolic state regulate pluripotency in embryonic stem cells (hESCs). PMID: 26571212
  18. results further reinforce a central role for NNMT in the regulation of energy homeostasis and provide further mechanistic insight into the consequences of enhanced NNMT expression PMID: 26456643
  19. White adipose tissue NNMT expression is regulated in human insulin resistance and type 2 diabetes and that plasma MNA correlates with increased tissue NNMT expression and the degree of insulin resistance. PMID: 25596852
  20. The downregulation of NNMT significantly reduced in vitro tumorigenicity of A549 cells. PMID: 25204218
  21. increasing Nnmt expression or MNAM levels stabilizes sirtuin 1 protein, an effect that is required for their metabolic benefits PMID: 26168293
  22. Data sugguest that NNMT plays an important role in PANC-1 cell proliferation, metastatic potential and survival under metabolic stress. PMID: 25592232
  23. results suggest that the NNMT SNP rs694539 may have a role in the etiology of schizophrenia in a Han Chinese female population PMID: 25317069
  24. NNMT is associated with microRNA-1291-altered pancreatic carcinoma cell metabolome and suppressed tumorigenesis. PMID: 25115443
  25. NNMT enhances the capacity of tumorigenesis associated with the inhibition of cell apoptosis and the promotion of cell cycle progression in human colorectal cancer cells PMID: 25201588
  26. Down-regulation of NNMT induces apoptosis via the mitochondria-mediated pathway in breast cancer cells. PMID: 24558488
  27. The rs694539 variant of NNMT gene is a genetic risk factor for developing nonalcoholic steatohepatitis. PMID: 23964925
  28. NNMT expression regulates neurone morphology in vitro via the sequential activation of the EFNB2 and Akt cellular signalling pathways. PMID: 23764850
  29. Data indicate that nicotinamide N-methyltransferase (NNMT) positively correlated with protein kinase B (pAkt) expression and was independent adverse prognosticators of patient survival. PMID: 23838801
  30. Genetic association of the rs694539 variant of nicotinamide-N-methyltransferase gene with bipolar disorder. PMID: 24004542
  31. The nicotinamide N-methyltransferase expression levels were significantly higher in patients with bladder tumor compared to controls that showed very low or undetectable amounts of NNMT transcript and protein. PMID: 23097023
  32. High serum NNMT is associated with kidney cancer. PMID: 23479363
  33. using metabolomics, observation that NNMT impairs the methylation potential of cancer cells by consuming methyl units from S-adenosyl methionine to create the stable metabolic product 1-methylnicotinamide PMID: 23455543
  34. This study suggested that NNMT is involved in the aetiology of schizophrenia PMID: 21791160
  35. a marked increase in enzyme activity in oral cancer PMID: 22628313
  36. Structural basis of substrate recognition in human nicotinamide N-methyltransferase PMID: 21823666
  37. NNMT has a crucial role in cellular invasion via activating PI3K/Akt/SP1/MMP-2 pathway in clear cell renal cell carcinoma (ccRCC). PMID: 21045016
  38. NNMT is over-expressed in a large proportion in renal cell cancers. High NNMT expression is significantly associated with unfavorable prognosis. PMID: 20104648
  39. the present study suggests that NNMT may have potential as a biomarker and as a therapeutic target for OSCCoral squamous cell carcinoma PMID: 19924637
  40. A potential role in predicting response to radiation in bladder cancer PMID: 12216074
  41. HNF-1beta functions as a transcription activator for NNMT gene expression in some papillary thyroid cancer cells PMID: 15486044
  42. A genomewide exploration suggested NNMT as a new candidate and major determinant of plasma homocystein levels. PMID: 15849667
  43. NNMT serum levels may have significance in the early detection and in the management of patients with colorectal cancer. PMID: 16166432
  44. depsipeptide represses NNMT and HNF-1beta gene expression in some papillary thyroid cancer cells PMID: 16676400
  45. NNMT genotype is not a strong determinant of the tHcy concentration but it may have a modifying effect on plasma homocysteine concentration in Japanese men PMID: 17434578
  46. NNMT is a novel Stat3-regulated gene and may be a potential candidate for a tumor marker of various kinds of cancers PMID: 17922140
  47. No association was found between infant nicotinamide N-methyl transferase gene variants and risk for spina bifida in our study population. PMID: 18553462
  48. Adipose tissue ss a source of nicotinamide N-methyltransferase and homocysteine PMID: 18996527
  49. For the first time, we associate the RFC1 80G>A and NNMT IVS -151C>T variants to an increased acute lymphoblastic leukemia susceptibility. PMID: 19020309
  50. NNMT gene expression is associated with tumor stage and DFS time in hepatocellular carcinoma cases. PMID: 19216803

Show More

Hide All

Subcellular Location
Cytoplasm.
Protein Families
Class I-like SAM-binding methyltransferase superfamily, NNMT/PNMT/TEMT family
Tissue Specificity
Predominantly expressed in the liver. A lower expression is seen in the kidney, lung, skeletal muscle, placenta and heart. Not detected in the brain or pancreas.
Database Links

HGNC: 7861

OMIM: 600008

KEGG: hsa:4837

STRING: 9606.ENSP00000299964

UniGene: Hs.503911

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*