Recombinant Human Non-histone chromosomal protein HMG-17 (HMGN2)

In Stock
Code CSB-EP010570HU
Abbreviation Recombinant Human HMGN2 protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
HMGN2
Uniprot No.
Research Area
others
Alternative Names
High mobility group (nonhistone chromosomal) protein 17 ; high mobility group nucleosomal binding domain 2; High mobility group nucleosome-binding domain-containing protein 2; High mobility group protein N2 ; HMG17; HMGN2; HMGN2_HUMAN; MGC5629; Non histone chromosomal protein HMG 17; Non-histone chromosomal protein HMG-17; Nonhistone chromosomal protein HMG 17; nonhistone chromosomal protein hmg-17
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-90aa
Target Protein Sequence
MPKRKAEGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPKPKKAPAKKGEKVPKGKKGKADAGKEGNNPAENGDAKTDQAQKAEGAGDAK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
36.4 kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The region for expressing recombinant Human HMGN2 contains amino acids 1-90. The theoretical molecular weight of the HMGN2 protein is 36.4 kDa. The HMGN2 protein was expressed in e.coli. The HMGN2 gene fragment has been modified by fusing the N-terminal GST tag, providing convenience in detecting and purifying the recombinant HMGN2 protein during the following stages.

The human non-histone chromosomal protein HMG-17, encoded by the HMGN2 gene, is involved in chromatin structure regulation and plays a role in transcriptional regulation. HMG-17 binds to nucleosomes and alters the structure of chromatin, affecting the accessibility of transcription factors to DNA. HMG-17 is known to influence gene expression, participating in both activation and repression of transcription. Additionally, it has been implicated in various cellular processes, including DNA repair and maintenance of genomic stability. Research on HMGN2 spans multiple areas, such as understanding its precise mechanisms in chromatin dynamics, its impact on gene regulation, and its potential implications in diseases like cancer. Investigations into HMGN2 contribute to unraveling the complex network of chromatin-associated proteins and their roles in cellular function.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Binds to the inner side of the nucleosomal DNA thus altering the interaction between the DNA and the histone octamer. May be involved in the process which maintains transcribable genes in a unique chromatin conformation.
Gene References into Functions
  1. these results uncover a novel link between nuclear protein HMGN2 and Nrf2-mediated cellular redox circumstance and suggest roles of HMGN2 in autonomous immune response to Pseudomonas aeruginosa infection PMID: 28408162
  2. HMGN1 and HMGN2 remodel core and linker histone tail domains within chromatin. PMID: 28973435
  3. Results provide evidence that HDAC6 could regulate HMGN2 acetylation levels and binding to Stat5a-responsive promoters, and therefore, Stat5a transcriptional activity in breast cancer cells. PMID: 27358110
  4. elucidate a novel mechanism whereby the linker histone H1 prevents STAT5 binding at promoter DNA, and the PRL-induced dissociation of H1 mediated by HMGN2 is necessary to allow full STAT5 recruitment and promote the biological effects of PRL signaling PMID: 28035005
  5. Data show that high mobility group nucleosomal binding domain 2 (HMGN2) knockdown induced the increased expression of alpha5beta1 integrin on cell membranes, which resulted in a significant increase in Klebsiella pneumoniae internalization. PMID: 27460641
  6. Data show that chronic lymphocytic leukemia (CLL) cells present high-mobility group nucleosome-binding protein 2 (HMGN2) at membrane. PMID: 25156469
  7. enhanced expression of HMGN2 in osteosarcoma cells by HMGN2 lentivirus, exerts inhibitory effects on growth and migration of osteosarcoma cells. PMID: 25530340
  8. HMGN2 is an anti-tumor effector molecule of CD8 T cells. PMID: 25060707
  9. A polypeptide, HMGN2, was isolated and may be an antimicrobial effector molecule of mononuclear leukocytes. PMID: 16204630
  10. HMGN2 is modified by covalent attachment of small ubiquitin-related modifier 1 (SUMO1) by pro-inflammatory signal and identified the major SUMOylated lysine residues that localize to the HMGN2 nucleosome-binding domain at Lys-17 and Lys-35. PMID: 24872413
  11. HMGN2 is a bona fide Aurora B substrate in vivo and show that its dynamic association to chromatin is controlled by Aurora B. PMID: 22267324
  12. HMGN2 acts as a positive modulator of nuclear factor kappaB signalling to promote lipopolysaccharide-induced beta-defensin-2 expression. PMID: 21518253
  13. HMGN2 protein has antimicrobial activity and is probably involved in innate immunity in vivo. PMID: 20842856
  14. The association of the PRLr with HMGN2 enables Stat5a-responsive promoter binding, thus facilitating transcriptional activation and promoting anchorage-independent growth. PMID: 21816901
  15. HMGN2 binds to both the acidic patch in the histone H2A-H2B dimer and to nucleosomal DNA near the entry/exit point, "stapling" the histone core and the DNA. PMID: 21730181
  16. fragment of the HMGN2 protein homes to the nuclei of tumor cells and tumor endothelial cells and tumor endothelial cells in vivo PMID: 12032302
  17. each of the 4 amino acids in the R-S-RL motif are the only residues absolutely essential for anchoring HMGN protein to nucleosomes, both in vivo and in vitro. PMID: 18299391

Show More

Hide All

Subcellular Location
Nucleus. Cytoplasm. Note=Cytoplasmic enrichment upon phosphorylation.
Protein Families
HMGN family
Database Links

HGNC: 4986

OMIM: 163910

KEGG: hsa:3151

STRING: 9606.ENSP00000355228

UniGene: Hs.181163

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*